PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000759.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 544aa    MW: 61480 Da    PI: 5.7074
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000759.1_g00011.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS264.92.8e-811725422374
                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...f 84 
                              v+lLl++ e vs ++ +la+ +++r   +as +g+p+qRla+ f+eAL +r+ r  ++ +k ++ ++ ++ ++s +l++  +    
  Itr_sc000759.1_g00011.1 172 VHLLLAAGEEVSRRQYHLATGFISRCLWIASDSGTPVQRLAFQFAEALTERIER-ETGRFKGMSEERLARCRESMALSSNPAilaS 256
                              89****************************************************.5555555555554444444444443333346 PP

                     GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesgskeeleetgerLakf 168
                              ++  P+ ++ +++  qaI e v++++++  +D++i  G+QW  L+qaLa++++++p  ++R+T+vg    +++e++ee g+rL++f
  Itr_sc000759.1_g00011.1 257 HQGLPFGQVIQFAGIQAIIERVKNARKIRLLDINIRTGIQWTILMQALAEQDRSSPieRIRLTAVGV---VEREKMEECGKRLQSF 339
                              8899*********************************************766554444*********...78************** PP

                     GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                              A++l++pf f+++  ++l+d++ +  +v+ +E++aV   + l ++ +++ +l+    ++++ +++l+P v+vv+e ea+hns+sF 
  Itr_sc000759.1_g00011.1 340 ADSLNLPFCFETVFLSDLKDFREDLVQVEDEEVVAVMANIVLRTMIARPDCLD----TLMRRIRRLRPAVMVVAEVEANHNSPSFI 421
                              *********************************************96665555....5**************************** PP

                     GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                              +rf+eal +y a fd+le  l r++  r+ +E   +g+ i+n+va+eg+er+ r+ + e Wr+ + ++ +++++ls++ + qa+l+
  Itr_sc000759.1_g00011.1 422 NRFVEALFFYGAYFDCLEDCLDRDDPCRRIMEGLHFGEGIRNIVATEGEERFTRNVKIEVWRAYFARFSMEEMQLSDSSVYQANLV 507
                              ************************************************************************************** PP

                     GRAS 341 lrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +k++ ++  +++++ + l++gWk+ p+ sv++W+
  Itr_sc000759.1_g00011.1 508 GQKFGnGNSCTLDSSGKGLIIGWKGIPIHSVTCWK 542
                              *****88889999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.977145521IPR005202Transcription factor GRAS
PfamPF035149.7E-79172542IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MPASVSFPSG SAPFNHDRHL HPKGSVNDEL RSSKDDNDWF EMEGCDDFNS LFAGDKRIEH  60
LIIEDQNQIP SPNPQVSELK PQQTPFSSAC FEILKCYGRF FKDRSSLTSK TDRIDVSGAG  120
GKLSVAEILK LAGERYIQFF TQKADGFSAF FHPYASALSG ISVDDIRDVE IVHLLLAAGE  180
EVSRRQYHLA TGFISRCLWI ASDSGTPVQR LAFQFAEALT ERIERETGRF KGMSEERLAR  240
CRESMALSSN PAILASHQGL PFGQVIQFAG IQAIIERVKN ARKIRLLDIN IRTGIQWTIL  300
MQALAEQDRS SPIERIRLTA VGVVEREKME ECGKRLQSFA DSLNLPFCFE TVFLSDLKDF  360
REDLVQVEDE EVVAVMANIV LRTMIARPDC LDTLMRRIRR LRPAVMVVAE VEANHNSPSF  420
INRFVEALFF YGAYFDCLED CLDRDDPCRR IMEGLHFGEG IRNIVATEGE ERFTRNVKIE  480
VWRAYFARFS MEEMQLSDSS VYQANLVGQK FGNGNSCTLD SSGKGLIIGW KGIPIHSVTC  540
WKFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3420154233375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019188248.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A1S4A0M90.0A0A1S4A0M9_TOBAC; DELLA protein RGL1-like
STRINGXP_009628660.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-49RGA-like 1