PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000759.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 511aa    MW: 57497.7 Da    PI: 6.307
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000759.1_g00010.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS265.71.6e-811385091374
                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl... 83 
                              lv+lLl++ e +s ++ +la+ +++r   +as +g+p+qRla++f+eAL +r+ r++   ++ ++ ++ ++ ++s +l+   +   
  Itr_sc000759.1_g00010.1 138 LVHLLLAAGEELSRRQYHLATGFISRCLWTASDSGTPVQRLAFHFAEALTERIERETG-RFRGVSEERLARCRESMALSCNPAvla 222
                              689****************************************************443.344443333333333333333222434 PP

                     GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesgskeeleetgerLak 167
                               ++  P+ ++ +++  qaI e v++++++H +D++i  G+QW  L+qaLa++ +++p  ++R+T++g     ++e++ee g+rL++
  Itr_sc000759.1_g00010.1 223 SHQGLPFGQVIQFAGIQAIIERVKNARKIHLVDINIRSGIQWTILMQALAEQHDSSPieRIRLTAIGV---AEREKMEECGKRLQS 305
                              78899**********************************************997777679********...579************ PP

                     GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                              fA++l++pf f+++  ++l+d++ +  +++ +E++aV  +  l ++ +++ +l+     +++ +++l+P v+vv+e ea+hns+sF
  Itr_sc000759.1_g00010.1 306 FADSLNLPFCFHTVFLSDLKDFREDLVQIEDEEVVAVLASTVLRTMIARPYCLDG----LMRGIRGLRPAVMVVAEVEANHNSPSF 387
                              ***********************************************99999988....*************************** PP

                     GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                               +rf+eal ++ a fd+l+  l r++  r+++E   +g+ i+n+va+eg+er+++  + e Wr+ + ++ +++++ls++ ++qa+l
  Itr_sc000759.1_g00010.1 388 INRFVEALFFFGAYFDCLDDCLDRDDPCRRTIEGLHFGEGIRNMVAAEGEERFAKSVKIEVWRSYFARFAMEEMQLSDSSVCQANL 473
                              ************************************************************************************** PP

                     GRAS 340 llrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              + +k++ ++  +++++ + l++gWk+ p+ sv++W+
  Itr_sc000759.1_g00010.1 474 VGKKFGnGNSCTLDSSGKGLIFGWKGTPMHSVTCWK 509
                              ******88889999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.388112488IPR005202Transcription factor GRAS
PfamPF035145.5E-79138509IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MIMHDWFEME ECDDFDSLFA GTKKIEHLIE AQNQMPSPNP QVSEPKPHQT PFSSACFQIL  60
KCYGRFFKDR SSVITSKTDH IHARGAGGKL SVAEILKLAG ERYIQFFTQN GDGFSAFFHP  120
YASALSGISV DDIRDVELVH LLLAAGEELS RRQYHLATGF ISRCLWTASD SGTPVQRLAF  180
HFAEALTERI ERETGRFRGV SEERLARCRE SMALSCNPAV LASHQGLPFG QVIQFAGIQA  240
IIERVKNARK IHLVDINIRS GIQWTILMQA LAEQHDSSPI ERIRLTAIGV AEREKMEECG  300
KRLQSFADSL NLPFCFHTVF LSDLKDFRED LVQIEDEEVV AVLASTVLRT MIARPYCLDG  360
LMRGIRGLRP AVMVVAEVEA NHNSPSFINR FVEALFFFGA YFDCLDDCLD RDDPCRRTIE  420
GLHFGEGIRN MVAAEGEERF AKSVKIEVWR SYFARFAMEE MQLSDSSVCQ ANLVGKKFGN  480
GNSCTLDSSG KGLIFGWKGT PMHSVTCWKF S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3615650921375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019188249.10.0PREDICTED: DELLA protein GAIP-like
TrEMBLA0A1S4A0M90.0A0A1S4A0M9_TOBAC; DELLA protein RGL1-like
STRINGXP_009628660.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-47RGA-like 1