PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000744.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 452aa    MW: 50848.9 Da    PI: 7.0254
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000744.1_g00009.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.5e-31249303155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+r+rWt++LH+rFve v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR 
  Itr_sc000744.1_g00009.1 249 KTRIRWTQDLHDRFVESVDRLGGAEKATPKAILKLMDSEGLTIFHVKSHLQKYRN 303
                              68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.188246306IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-27247304IPR009057Homeodomain-like
SuperFamilySSF466891.08E-15247303IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-24249304IPR006447Myb domain, plants
PfamPF002491.2E-6253302IPR001005SANT/Myb domain
PfamPF143791.6E-20376422IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MRFQNFSSAQ ERTQQSYGFG RDFGLELLRN PHQSFGAQQH YAPPGMMVQC FLPPDEASMC  60
HQQQQQQQQN VGSASASSTS SIMHQIGSLE AFYATEQCLG LSQYEDEDEN RSKNFDQQIV  120
PYQQSGNGVF GYSQAQTEPD LQAKNLAQAF FKSQFSNGSE RLYRNPPFCN NLSEKERILL  180
LKKKLFEDVI PDGPIKGHPA ITLDANQDYG VSHNPPNGSH LANLRHHPGN PLTCPPPNSA  240
SPAGSMSSKT RIRWTQDLHD RFVESVDRLG GAEKATPKAI LKLMDSEGLT IFHVKSHLQK  300
YRNAKYRPES PEGTYQLQIP DFAKKIPQIT SPFRPLPNNP LATWPCPTIP SHLVAGKSEK  360
STLNNASEID SKTGTQIKEA LQMQLEVQRR LHEQLEIQKK LQMRIEEQSK QLKKIFDQQQ  420
KTTKSLLESQ NSCISSPEDD DDPLISREAD VS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-23249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-23249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-23249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-23249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-23249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-23249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-23249307260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-23249307260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019187721.10.0PREDICTED: uncharacterized protein LOC109182119
TrEMBLA0A1J6J5C81e-99A0A1J6J5C8_NICAT; Myb family transcription factor phl5
STRINGSolyc10g078720.1.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.14e-57G2-like family protein