PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000735.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CO-like
Protein Properties Length: 371aa    MW: 40361.2 Da    PI: 6.8353
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000735.1_g00014.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.96.3e-063475439
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                             + C+ ++   +  fC+ + +++C +C  + H        H++
  Itr_sc000735.1_g00014.1 34 KPCDYCKIAVALVFCRVDAVFMCLECDAKVHATnklgskHER 75
                             57******99*******************9965667777765 PP

2zf-B_box25.62.5e-0876121342
                 zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                               ++C+ +e+ ++   C+ +   lC +C   +H+       H++vp+
  Itr_sc000735.1_g00014.1  76 VWVCEVCEHAPAAVTCKADAAALCVTCDRDIHSAnplaqrHERVPV 121
                              689*****************************66899999999986 PP

3CCT69.77.4e-24297340144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Itr_sc000735.1_g00014.1 297 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 340
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.8E-83178IPR000315B-box-type zinc finger
CDDcd000216.27E-73578No hitNo description
PROSITE profilePS501198.6743678IPR000315B-box-type zinc finger
PROSITE profilePS5011910.82274121IPR000315B-box-type zinc finger
PfamPF006431.9E-675121IPR000315B-box-type zinc finger
CDDcd000212.36E-977121No hitNo description
SMARTSM003363.5E-1079121IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787297339IPR010402CCT domain
PfamPF062035.7E-18297339IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MVIGNCGGGG GGSGDSVINS RCLSGGWGAA AVAKPCDYCK IAVALVFCRV DAVFMCLECD  60
AKVHATNKLG SKHERVWVCE VCEHAPAAVT CKADAAALCV TCDRDIHSAN PLAQRHERVP  120
VTPFYDTAES VVKSTTAALL VPINDSNPPN FAHENFASDP WNSSASITSK LPENAPAGMK  180
SAEFSLFDSD NFLDFEYPVS WESNSQNQYN SDRVVPIQTI KTSAPIIPQE KHFEIDFTRS  240
NLTSYNSGFT KPSLSVSSSL DVGVVPDGSS VSEISYRNIG AGSVDSRGGS QWNGMDREAR  300
VLRYREKRKN RKFEKTIRYA SRKAYAETRP RIKGRFAKRT EVESESDIDT LFSSADSAAD  360
VGRFSVVPLI W
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019160356.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like isoform X3
SwissprotQ9FHH81e-100COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A068U4411e-139A0A068U441_COFCA; Uncharacterized protein
STRINGXP_009608073.11e-130(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.14e-89CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]