PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000723.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 336aa    MW: 37232.2 Da    PI: 6.952
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000723.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-32223278156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              kpr++W+peLH+rFv+a+++LGG++ AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Itr_sc000723.1_g00001.1 223 KPRRCWSPELHQRFVDALDKLGGAQAATPKQIREIMNVDGLTNDEVKSHLQKYRLH 278
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-30220282IPR009057Homeodomain-like
PROSITE profilePS5129414.342220280IPR017930Myb domain
SuperFamilySSF466893.94E-18221281IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-26223278IPR006447Myb domain, plants
PfamPF002491.3E-7225276IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MAQDFMSERN IDLNCEFVVP KSVSIAFAEI SAIDDPSQKL LKLYSLLQAL EEEAKKIYVI  60
RREVPYATSL LTDEIETVRE EYLKLKGKEK LPALASVEVE EFVLLKGSSN GDRGTTRSND  120
QGEKMNWMSS TGLWNHPVTS SNSDSKKPSN QLFPTRLGCV NKSIQLFVPY KTMTAEEVAA  180
LKADALPVPA LSLSPPSVPQ SVVYKSSYHS HSSKTLNKQE QRKPRRCWSP ELHQRFVDAL  240
DKLGGAQAAT PKQIREIMNV DGLTNDEVKS HLQKYRLHVR RLTASPPPST STGAHSSLPE  300
GPLHLGIPAT CREVSVTVTG LNAVEESDEE ESVRGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-15223276255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-15223276255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-15223276154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-15223276154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-15223276154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-15223276154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-15223276255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-15223276255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-15223276255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-15223276255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-15223276255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-15223276255Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019176330.11e-133PREDICTED: myb family transcription factor EFM-like
RefseqXP_019176331.11e-133PREDICTED: myb family transcription factor EFM-like
RefseqXP_019182597.11e-133PREDICTED: myb family transcription factor EFM-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA84972229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.16e-33G2-like family protein