PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000680.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 392aa    MW: 44424.5 Da    PI: 8.4473
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000680.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-3170123255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              prlrWtp+LH rFv+ave+LGG+e+AtPk +l+lm++kgL ++hvkSHLQ+YR+
  Itr_sc000680.1_g00001.1  70 PRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMDIKGLNIAHVKSHLQMYRS 123
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-3066124IPR009057Homeodomain-like
PROSITE profilePS5129411.54366126IPR017930Myb domain
SuperFamilySSF466893.4E-1468125IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-2270125IPR006447Myb domain, plants
PfamPF002497.5E-871122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MEESGETVCS KTTNDSNKFE EEEEDEEDET NESPRKQAVK DGGSSSNSTV EESGEKKASS  60
VRPYVRSKMP RLRWTPDLHL RFVHAVERLG GQERATPKLV LQLMDIKGLN IAHVKSHLQM  120
YRSKKTEDPS QGFANHRPFM EGVDRNIFNL SQLPMFKIFN NQRLNPPFRY GDDSYRNCQE  180
KWMNGTPMAH GTADRGRPYE ALYERFRSNN YDFPRETIPP FTERSNRGLH ELKEKLGSFL  240
ENQTWHHQFA PQNPIQHQPI QVPEPKTATR TGSSVGSWVT DCRPEPKTNG FWVADRGQEP  300
KTTTLENRNA AVSAKLKKQE TMKRKADLDL NLSLGIKSAK EKSMEGLGED ESGLTLSLSS  360
SSSSKLRKLN QDDTNNFTKS GKGGASTLDL TL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1671125458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1671125458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1671125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1671125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1671125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1671125357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1671125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1671125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1671125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1671125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1671125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1671125458Protein PHOSPHATE STARVATION RESPONSE 1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019186299.10.0PREDICTED: uncharacterized protein LOC109181007 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.18e-56G2-like family protein