PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000654.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 349aa    MW: 38166.2 Da    PI: 6.0165
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000654.1_g00006.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-3295148255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              prlrWtp+LH +Fv+ave+LGG+++AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Itr_sc000654.1_g00006.1  95 PRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQLMNIKGLSIAHVKSHLQMYRS 148
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.5591151IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-3091149IPR009057Homeodomain-like
SuperFamilySSF466892.33E-1592150IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-2395150IPR006447Myb domain, plants
PfamPF002493.6E-996147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MKAAETDQKV MEEMMMKEGI SCSTEDSKSG PEFLGAEIEP EGEEEEEEEE EDGKGEKGNN  60
GSSSSNSTVE ENNGKKLLGN SSGGSVRQYV RSKTPRLRWT PDLHLCFVHA VERLGGQDRA  120
TPKLVLQLMN IKGLSIAHVK SHLQMYRSKK ADEPNPVTPN GRLLLGNGDS HIFNFSQLQR  180
LQGFNPTPVT TSLRFDDSSW SHRHHHQPYS SVYNPYLNGG AAAMIRHGFG GNYVNGGRSE  240
FPMMSRQCSD NVAAPPQLFP NQRIPAAAQN GEVTAAGAGK RKLPADSDVN LDLNLSLKTR  300
DGGGGNDEKR AKGDDKYEDS TNLSLSLFPS SQNDDQTTTV KKTTLDLTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1796150357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1796150357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1796150357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1796150357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAPTransfer from AT2G40260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019192424.11e-177PREDICTED: two-component response regulator ARR18-like
TrEMBLA0A328E4424e-89A0A328E442_9ASTE; Uncharacterized protein
STRINGXP_009791663.19e-78(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85732129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.12e-40G2-like family protein