PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000576.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CPP
Protein Properties Length: 801aa    MW: 86928.2 Da    PI: 6.5486
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000576.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.54.2e-16511547339
                      TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              +k+CnCkkskClk+YCeCfaag++C e C+C+dC+Nk
  Itr_sc000576.1_g00003.1 511 CKRCNCKKSKCLKLYCECFAAGVYCVEPCSCQDCFNK 547
                              89**********************************8 PP

2TCR51.12.7e-16590628139
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Itr_sc000576.1_g00003.1 590 RHKRGCNCKKSGCLKKYCECYQGGVGCSINCRCEGCKNA 628
                              589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.9E-17509550IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.705510630IPR005172CRC domain
PfamPF036389.2E-12512547IPR005172CRC domain
SMARTSM011147.5E-18590631IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.9E-12592628IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 801 aa     Download sequence    Send to blast
MGGVEANLQS ENAERKSSGS EVGGSEEGGP AVMDTPDRTK INQIVTPLSK IEESPVFNFL  60
NSLSPIEPVK SAHITQTFNS LSFSSSPSVF TSPHMSMLKE SRFLRRHQLP DPSKPEFSSD  120
NDHKVNSSQV HNLDVSDNMS EQPESYLGSC TIEASIRASY EFSKLAVELV KSLDYDCSSP  180
NSSTVANCDI KHKSFSALAG SSDTIVPVAN DVAGKKSSLR TQVNMEGASQ IDRNEEDAGC  240
DFEGLISGTG DTLIFDSPND TGTIKKEVDP ISRTYSFVRN EIQNIKTFSA VGSGENVEEI  300
IETENQSTQS GEGSELNQYA EVQDINPDSS VCIKSLVGCT SEKMEADMVS GLNRGIRRRC  360
LVFDMTGIRK KHLDENTGSD SGSSLWTQSD GNTTSTDKHL VGTKSRCEPS RCVLPGIGLH  420
LNALAVAAKD GHAVKHEALA SGQQLLVAPG STANYRSLTL ISKARVALED GIHLNEDANQ  480
SPGYSVNEEL NQSSSPRKKK RRMESGESEG CKRCNCKKSK CLKLYCECFA AGVYCVEPCS  540
CQDCFNKPIY EDTVIATRKQ IESRNPLAFA PKVIRATETL AEIGTPASAR HKRGCNCKKS  600
GCLKKYCECY QGGVGCSINC RCEGCKNAFG RKDGTEAELE EEETNIHEKG CIDESSQKSA  660
LHTEIQQMPD SFLPATPLRS KRPPMQPPVL KNKPTRMPSI LGVGSSSGGT YAASQGLGRP  720
RFFRPLPKFH KQFESIEEDE IPSTLQGNTS PTSGIVKSTS PNSKRVSPPH TEFETSPGRR  780
SSSRKLILQS IPSFPSLTPN N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-1851262712120Protein lin-54 homolog
5fd3_B7e-1851262712120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1497501KKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019155008.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLA0A1U7W7L20.0A0A1U7W7L2_NICSY; protein tesmin/TSO1-like CXC 2 isoform X2
STRINGXP_009770238.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-131TESMIN/TSO1-like CXC 2