PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000570.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 266aa    MW: 30023.9 Da    PI: 7.0131
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000570.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.31.9e-24130179151
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                              kprl+W+pe+H+rFv+av++L G +kA+Pk+i+e+m+ +gLt+ehv SHLQ
  Itr_sc000570.1_g00003.1 130 KPRLNWNPEMHQRFVQAVNKL-GYDKAVPKKIVEFMNEPGLTREHVSSHLQ 179
                              79*******************.***************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.4E-15127180IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-24128179IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-21130179IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MHLRVPAQPR LLSSLTTTFL TLFLSQLFRL PLMASGVIKL HVTGLDCNVS SYIANFSDIK  60
DMKELWQSAF EKEKARKAAI SSPVVGVETT STENNEPSLD GEPGNDHHNR KAKELREKQN  120
EESGGETKKK PRLNWNPEMH QRFVQAVNKL GYDKAVPKKI VEFMNEPGLT REHVSSHLQE  180
EVALEHGDAR GETGEVPCGR DEEAVIESDG DEYCGVGDDL ERHRRQRWWV ESRTVLLRAS  240
SLSRRPPPPP PNPLCPPPPE RLRRVG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019160991.13e-70PREDICTED: two-component response regulator ARR2-like
TrEMBLA0A328DTD11e-39A0A328DTD1_9ASTE; Uncharacterized protein
TrEMBLA0A484MAS53e-39A0A484MAS5_9ASTE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA36591620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-21response regulator 2