PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000535.1_g00031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 408aa    MW: 45336.7 Da    PI: 6.9887
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000535.1_g00031.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.94.7e-333589155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprl+Wt +LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Itr_sc000535.1_g00031.1 35 KPRLKWTADLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 89
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.9253292IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-313390IPR009057Homeodomain-like
SuperFamilySSF466891.65E-163490IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-233590IPR006447Myb domain, plants
PfamPF002497.0E-103788IPR001005SANT/Myb domain
PfamPF143791.8E-24135182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MHPSTRMSVP PERHLFLQGG SGHGDSGLVL STDAKPRLKW TADLHERFIE AVNQLGGADK  60
ATPKSVLKLM GIQGLTLYHL KSHLQKYRLS KNLHLQANSG SNKTTTGGSG TDKIYEANAN  120
HMNNPSTGPQ TNKNVHISEA IQMQIEVQRR LHEQLEVQRH LQLRIEAQGK YLQAVLEKAQ  180
ETLGRQNLGT MGLEAARVQL SELVSKVSNQ CLNSAFSEMK EAPGLGPQQA RATQPTDCSL  240
DSCLTSCEGA SREHEMHNSQ MGLGTLNLRA YMDPKDMENE TRRQQSEVRW SDELKESGKF  300
LCGMAEDLEK GDDKERKCSD LSMSIGLEGG RWNSKKSYEF TGTDGDAKLY SRPADRSDSS  360
AGKTEKQKMA QQEYKLPYFG PKLDLNTEDE TDVASSCKQF DLNGFSWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-203591157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-203591157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-203591157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-203591157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019153103.10.0PREDICTED: myb-related protein 2-like isoform X1
SwissprotQ9SQQ91e-129PHL9_ARATH; Myb-related protein 2
TrEMBLA0A484MRS10.0A0A484MRS1_9ASTE; Uncharacterized protein
STRINGXP_009758035.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-129G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]