PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000529.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 272aa    MW: 29539.2 Da    PI: 7.5012
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000529.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.4e-333791155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Itr_sc000529.1_g00001.1 37 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 91
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-323492IPR009057Homeodomain-like
PROSITE profilePS5129412.4553494IPR017930Myb domain
TIGRFAMsTIGR015571.8E-243792IPR006447Myb domain, plants
SuperFamilySSF466892.69E-163794IPR009057Homeodomain-like
PfamPF002497.9E-93990IPR001005SANT/Myb domain
PfamPF143797.2E-23140183IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MVMDGMYAGG GGGAGGSCYS YGDGGGGGGV MMTRDPKPRL RWTADLHDRF VDAVTKLGGP  60
DKATPKSVLR LMGLKGLTLY HLKSHLQKYR LGQQGKKQNT GDQNKENSGD SCRQFSIHSS  120
ATSTPSSSMN CMQGEIPFGD AVRCQIEVQN RLQEQLEVQK KLQMRIEAQG KYLQAILEKA  180
QKSLSIDMNS PSSVEATRAQ LNDFNLALSS FMENMNGQSI GKAMNANLPS SDFLGEDEED  240
DKRDINIKLH GSSMNFDLNC GSSHDFVAAN GR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-203790154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-203790154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-203790154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-203790154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019152885.11e-167PREDICTED: myb family transcription factor PHL11-like
SwissprotC0SVS41e-79PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLM1AJD61e-113M1AJD6_SOLTU; Uncharacterized protein
STRINGSolyc08g076010.2.11e-113(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.12e-67G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]