PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000518.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 323aa    MW: 35098 Da    PI: 6.451
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000518.1_g00010.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.95.2e-3448102155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+rlrWt+eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Itr_sc000518.1_g00010.1  48 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 102
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.33745105IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-3247103IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1847102IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-2648103IPR006447Myb domain, plants
PfamPF002491.4E-950101IPR001005SANT/Myb domain
PfamPF143791.7E-23134180IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MYQPNGVSSS NLVHSNAIGI QPLESGPSTM DPISGGNNLN NNPSLASKQR LRWTNELHER  60
FVDAVAQLGG PDRATPKGVL RVMGVQGLTI YHVKSHLQKY RLAKYLPDSS SDGKKADKKE  120
SRDMISNLDG SSGMQITEAL KLQMEVQKRL HEQLEVQRQL QLRIEAQGKY LKKIIEEQQR  180
LSGVLSEAPG TGVNPAAESD NGTDPSTPVP TSESPHGDKH AKECAPAKSL SLDESFSSHH  240
EPLTPDSGGH ETSQIESPTG ERPSKLQKLD SGAALAQPNA MLTHPILESS LSPSYQQPDT  300
VFLTREHLSH SSGLSIGNED QRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2348105259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2348105259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-2348105158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2348105158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2348105158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2348105158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2348105259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2348105259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2348105259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2348105259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2348105259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2348105259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019184442.10.0PREDICTED: myb family transcription factor PHL7
SwissprotQ9SJW01e-127PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLF6HD661e-167F6HD66_VITVI; Uncharacterized protein
STRINGVIT_00s0475g00040.t011e-168(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27962451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-103G2-like family protein