PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000495.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 509aa    MW: 54398.4 Da    PI: 7.3987
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000495.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.8e-32286341156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Itr_sc000495.1_g00002.1 286 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 341
                              68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.338283343IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-28284344IPR009057Homeodomain-like
SuperFamilySSF466894.12E-16284344IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26286341IPR006447Myb domain, plants
PfamPF002499.2E-7288339IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MMASSSELSL DCKPQHSYSM LLKSFGDQQQ TTTTDHHQTS QKLEEFLARL EEERLKIDAF  60
KRELPLCMQL LTNAMEASRQ QLQSYRANNE GGTTRPVLEE FIPLKNSSSS CDNNGGAEKI  120
GAAANMASDK ANWMTSAQLW SDQGNELGAG GKKQQPCSIG VITSSPKENE IIGFSMSPKV  180
GNLEKRNSNN NGGGGGGGGA FLPFSKDRSS PAPTLALASS CEDNIEADKK NNNNSNNNVS  240
EIIIVNPPPS NKANNHSGGD AISSMSQPDG QTTSATAAAA TQPQRKARRC WSPDLHRRFV  300
NALQMLGGSQ VATPKQIREL MKVDGLTNDE VKSHLQKYRL HTRRPIPSPQ TAAAGAPQLV  360
VLGGIWVPPE YATAAATHGG APAAVAAATL YGAHPSVHPH AASQQHYCAT AAPQVAHHEF  420
YAPPPPLHQL HPPLLHHHHH QLHMYKPPSH SSPVSGDRSE SIEDGKSSAS GGSWKGDSGS  480
ENGGGERKVL VLREEGEVGN NGTEISLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-14286339154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-14286339154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-14286339154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-14286339154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019192374.10.0PREDICTED: myb family transcription factor EFM-like isoform X2
TrEMBLA0A218W1071e-157A0A218W107_PUNGR; Uncharacterized protein
STRINGevm.model.supercontig_127.551e-164(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87942229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-51G2-like family protein