PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000485.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family TCP
Protein Properties Length: 369aa    MW: 40659.1 Da    PI: 8.6753
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000485.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP40.78.6e-13195234241
                      TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGf 41 
                              + +kdr+sk++ +++ RdR vRls ++a++f+d+qd+L  
  Itr_sc000485.1_g00004.1 195 TDQKDRQSKVCIARETRDRCVRLSPNTAIQFYDVQDRLDT 234
                              568***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF080691.2E-7130IPR012606Ribosomal protein S13/S15, N-terminal
SMARTSM013860.0012155IPR012606Ribosomal protein S13/S15, N-terminal
Gene3DG3DSA:2.30.29.301.0E-669122IPR011993PH domain-like
PfamPF035311.6E-13124184IPR024954SSRP1 domain
PfamPF036341.1E-9196233IPR005333Transcription factor, TCP
PROSITE profilePS513698.752197255IPR017887Transcription factor TCP subgroup
Gene3DG3DSA:3.30.420.102.1E-6264345IPR012337Ribonuclease H-like domain
SuperFamilySSF530985.82E-9265347IPR012337Ribonuclease H-like domain
CDDcd062222.91E-13267367No hitNo description
PfamPF134569.1E-13269368No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006412Biological Processtranslation
GO:0005840Cellular Componentribosome
GO:0003676Molecular Functionnucleic acid binding
GO:0003735Molecular Functionstructural constituent of ribosome
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGRMESHSKG ISSSALPYKL TPPSWSRSLP KMSKITSVKG VTRSKILRIL KAHGLAPEIL  60
EDLSFVDMTD GHMFNNISLG GYGGTNLGQL KVHAGGILWK RLGGGKAVEV DKSDIAGLTC  120
MKTTFFHNSY GITPKEKQLS VNGKNWGEVD LTGNMLTFLV SSKQVFEISQ ADVSQTHLQA  180
KNDAIGINGC IVCPTDQKDR QSKVCIARET RDRCVRLSPN TAIQFYDVQD RLDTTDPCGI  240
VGMMSFGIIK SGRQSNVLMH FVDGVCIHVD ATVFPNREEG CILAVLHEGD RRYLAAKNGY  300
VKCLQDPTLA EAMAIKEALS WAKGCGWRKV NIYSDCQLVC NMLKSCLPIY SYVGCILRDC  360
LNLKRHFDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v7e_BN1e-1516619140S ribosomal protein S15
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1S3X6Y22e-46A0A1S3X6Y2_TOBAC; FACT complex subunit SSRP1
TrEMBLA0A1S4BGW52e-46A0A1S4BGW5_TOBAC; FACT complex subunit SSRP1
TrEMBLA0A1U7YDG52e-46A0A1U7YDG5_NICSY; FACT complex subunit SSRP1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.32e-12TCP family protein