PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000471.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 356aa    MW: 39863.9 Da    PI: 7.051
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000471.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.77.2e-30237292156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W++eL + Fv+a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Itr_sc000471.1_g00002.1 237 KQRRCWSQELQKLFVNALHQLGGPHVATPKQIRELMKVEGLTNDEVKSHLQKYRLH 292
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.31E-17234295IPR009057Homeodomain-like
PROSITE profilePS5129412.966234294IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-27234295IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-26237292IPR006447Myb domain, plants
PfamPF002491.0E-7239290IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MSTIGDASER VSMIDDYVRR LEEEMRKIDA FKRELPLCML LVNDAIVALK EEAVQCRRSR  60
VEPVLEEFIP LKKSSDDDDD KIETRRERGS REKVDWMNSV QLWSSGNNHC LSSKNDLKLV  120
KEQSLNLFFF PPSDTVTNPL TGLCPPLLGR TTSLAIEEEE NSSVTNDLLV SGKTMNPGKT  180
SAVPGLLLGT PAREYMVIGG LSSMDCVSRA AASSTASSSV RPQYHHHHQQ QQQTSRKQRR  240
CWSQELQKLF VNALHQLGGP HVATPKQIRE LMKVEGLTND EVKSHLQKYR LHIRRSAHTN  300
TSSANRFAPQ SGSPQGPLGT SLTRDNNMTE EEEEDDDDKS GRQIPKILTL TSKNGA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019170315.10.0PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A0V0I6V01e-84A0A0V0I6V0_SOLCH; Putative two-component response regulator-like APRR2-like
STRINGSolyc01g108300.2.15e-84(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-41G2-like family protein