PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000470.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 293aa    MW: 33255.3 Da    PI: 9.071
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000470.1_g00012.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.17.1e-272373151
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                             k+rl+Wt+eLH+ F +av+qLGG+e+AtPk il++m+++gLt++hvkSHLQ
  Itr_sc000470.1_g00012.1 23 KERLKWTQELHNLFEKAVNQLGGPERATPKGILKVMGIPGLTIYHVKSHLQ 73
                             68************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.0482080IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-242173IPR009057Homeodomain-like
SuperFamilySSF466893.23E-142274IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-202373IPR006447Myb domain, plants
PfamPF002491.5E-82573IPR001005SANT/Myb domain
PfamPF143796.2E-15132176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MPGKITELPP PKMGSARPEG SSKERLKWTQ ELHNLFEKAV NQLGGPERAT PKGILKVMGI  60
PGLTIYHVKS HLQFSLLVGT KHILQFSIRA NQAMQEKYRM SKFVPEDPIR GKFEMRSISE  120
ILPNFSATSG AQLNEALQIQ MNVYKRLSDQ HEVQRSLKMK MEAQGRFLER IMEEHRMKAT  180
CSSSSKPSCK SYSPMSLPSL CEESESNVKD IESDSEVVDK NEIRSNELFP QRKRIRFDEE  240
VMSQTYSFAS PSGSSLINNL QLPFSGMEMN NIPWSLMSYQ SPMLPAAMFD SLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-182373252Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-182373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-182373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-182373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-182373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-182373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-182373252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-182373252Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019162295.11e-152PREDICTED: myb family transcription factor PHL7-like
TrEMBLA0A1U7Y7T11e-102A0A1U7Y7T1_NICSY; protein PHR1-LIKE 1-like
STRINGXP_009799173.11e-102(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101012026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-44G2-like family protein