PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000452.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 206aa    MW: 23971 Da    PI: 7.2766
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000452.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like47.54e-15125174251
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                              p+ +W+    +rF+++ve+L G++ AtPk+ilelm+ k+Ltl++v+ H Q
  Itr_sc000452.1_g00004.1 125 PQFEWSVCFRHRFLNVVERLVGKKGATPKAILELMNEKDLTLNQVRNHFQ 174
                              7889********************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.6E-482109IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-12121174IPR009057Homeodomain-like
SuperFamilySSF466892.87E-6123174IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-12126174IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MECIQFRHSM VDDQSSSIEL IFVTSLDENH NRSYENRLCE KLKHSHSKWS DSFHHRFFNV  60
VERFGGKKDK NQAYGFKLCE KSKDPPSEWS ACLHHRFFNV VERLGGQKDE NQAYGVTLCD  120
KSKQPQFEWS VCFRHRFLNV VERLVGKKGA TPKAILELMN EKDLTLNQVR NHFQIGVEGE  180
NNDAPDNLMM SGDENPTRAI FLSCKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019154616.12e-79PREDICTED: uncharacterized protein LOC109151152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-11G2-like family protein