PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000404.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CPP
Protein Properties Length: 820aa    MW: 89664.5 Da    PI: 6.3539
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000404.1_g00009.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.21.1e-15522559340
                      TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              +k+CnCkkskClk+YCeCfaag++C e C C++C+Nk 
  Itr_sc000404.1_g00009.1 522 CKRCNCKKSKCLKLYCECFAAGVYCVEPCLCQECFNKP 559
                              89**********************************96 PP

2TCR512.8e-16606644139
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Itr_sc000404.1_g00009.1 606 RHKRGCNCKKSGCLKKYCECYQGGVGCSINCRCEGCKNA 644
                              589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.3E-16520561IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.323521646IPR005172CRC domain
PfamPF036382.6E-11523558IPR005172CRC domain
SMARTSM011147.5E-18606647IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.1E-12608644IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 820 aa     Download sequence    Send to blast
MRVESVVVER ESVESQVRKK EGEGVMDTPE RNKSNQIATP ISKFEVMHFS VTLAAIDLMH  60
LDSPVFNFLN SLSPIKPVKS VHITQTFNSL SFASLPSVFT SPHVNTLKES RFLRRHQLPD  120
PSKPEFSSDN DHRVERPVGT DLDVANDASE KEEESFDPQS CIVDASVQPS HESPKISAEL  180
VRTLDYECSS PMPSSGVRNK SLSQFAGSSV TIIPLVQDVS GKGLMGSEVN MEGVSQVDRN  240
KEAAGCEWES LITDAADLLI FDSPNDAEAF KKAMDSSPRS VPFVANEIQN METFSTVGFS  300
ELVGDGSETQ HQSAQPGGGN ELHQYADAQD IIPDSSLNNP VTGGPNEMDA EMVSGLYRGM  360
RRRCLVFEMT GARRQPLDDN SGSSSSILAE HDGNATSTEK HLVAVNESSR RILPGIGLHL  420
NALAVTPRDG KGAKHESFAS GKQLIIAPSS VANYHLITTS QESLNNSLAV VSSEREIVPM  480
RNGASLNEDA SQEPRYVTNE ELSQSSPKKK KRKVDSKESE GCKRCNCKKS KCLKLYCECF  540
AAGVYCVEPC LCQECFNKPI HEDTVLATRK QIESRNPLAF APKVIRSTDS MSETGDDSNK  600
TPASARHKRG CNCKKSGCLK KYCECYQGGV GCSINCRCEG CKNAFGRKDG SDPDLEEEET  660
DLFEKSVVDR SSQKLAIVQN EIEHIPDSAL PATPLRLKRP QMQFPFLSKN KPPRSSFLSI  720
GSSSGSASQG LGRPSFFQSL PKFDKQFETI KEDENEMPDV LQTACRSPIS GIKSGSPNSK  780
RVSPPHHHSE FGTSSSPGRR SSRKLILQSI PTFPSLTPNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1852364312120Protein lin-54 homolog
5fd3_B4e-1852364312120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1507512KKKKRK
2508513KKKRKV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019180463.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLA0A1U7W7L20.0A0A1U7W7L2_NICSY; protein tesmin/TSO1-like CXC 2 isoform X2
STRINGXP_009770238.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-155TESMIN/TSO1-like CXC 2