PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000390.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 133aa    MW: 15050.2 Da    PI: 9.3627
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000390.1_g00007.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like37.94.1e-12101132133
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktil 33 
                              kprl+Wtp+LH++Fv +v+q+ G  + +Pk+il
  Itr_sc000390.1_g00007.1 101 KPRLVWTPQLHQQFVAVVNQI-GLRNSVPKKIL 132
                              79*******************.9*********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23007.2E-52074No hitNo description
SuperFamilySSF466896.15E-799132IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-11100133IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-9101132IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MIFMISNGGC RLEDEEGPWG ACGYLLKPVR KEEIKLLWQH VVRHKQGNWG KGDIIRRPQA  60
AAFWDSSEMP PQQKSVENCG SSNNNRDEDT NATATTANVK KPRLVWTPQL HQQFVAVVNQ  120
IGLRNSVPKK ILD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019188286.11e-56PREDICTED: two-component response regulator ORR24-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-18response regulator 2