PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000363.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 380aa    MW: 42410 Da    PI: 6.5998
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000363.1_g00016.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.6e-33266321156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rFv+a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Itr_sc000363.1_g00016.1 266 KQRRCWSPELHKRFVNALQQLGGAQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 321
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.746263323IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-30263324IPR009057Homeodomain-like
SuperFamilySSF466895.38E-18263324IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-27266321IPR006447Myb domain, plants
PfamPF002492.9E-8268319IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGSIPSELSL DCRPVFVPRT ITQFLAEISL IGSLSDRVLM IDDYVARFED EMRKIDAFKR  60
ELPLCMLLVN DAIVALKEES VQCRKSKVEP VLEEFIPLKK SCDGGEDGGD RVEIIRKDKD  120
SREKMNWMSS AQLWHGENHC PSSEFTNKKP RTEANLRMTT EEAENSSITN DLLVSCKTRN  180
IGKAFMPFKR YSGFPTAVVM KEDKELPGIP GLSLGTPGFK NPREDMIIGC LNTKACGSIA  240
VSSASSSSVH SIPTGAQPQQ QQTSRKQRRC WSPELHKRFV NALQQLGGAQ VATPKQIREL  300
MQVDGLTNDE VKSHLQKYRL HTRRLPGSQA TSANQSVVFG NLFMPQDQSH ESSKQSSSQS  360
GSPQDPLHHQ DDSMEEEADE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-14266319255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-14266319255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-14266319154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-14266319154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-14266319154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-14266319154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-14266319255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-14266319255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-14266319255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-14266319255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-14266319255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-14266319255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019166421.10.0PREDICTED: myb family transcription factor EFM-like isoform X1
TrEMBLA0A328D0A01e-144A0A328D0A0_9ASTE; Uncharacterized protein
STRINGPGSC0003DMT4000663521e-141(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-53G2-like family protein