PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000352.1_g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 289aa    MW: 31158 Da    PI: 7.2961
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000352.1_g00026.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-3349103155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+rlrW++eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Itr_sc000352.1_g00026.1  49 KQRLRWSHELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 103
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.04346106IPR017930Myb domain
SuperFamilySSF466892.69E-1748103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-3248104IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-2549104IPR006447Myb domain, plants
PfamPF002492.5E-951102IPR001005SANT/Myb domain
PfamPF143792.9E-23135181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MYQPKAVLSS SLVPNKAIVS QQSLDFSAST MEPINGGNNL NNNPSLASKQ RLRWSHELHE  60
RFVDAVAQLG GPDRATPKGV LRVMGVQGLT IYHVKSHLQK YRLAKYLPDA SSDGKKPDNK  120
DSSDIISGLD DSSGMQITEA LKLQMEVQKR LHEQLEVQRQ LQLRIEAQGK YLKKIIEEQQ  180
QLGAVSEMPE SGATSASAGE NAPVSDNSTN LVTPVPASEP PHTENPANER NPVKGISLNA  240
SPSSHNEALS PDSSCHAASA VERPSKKQKV GAEAAAFTQP DAMLTKLLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2349106259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2349106259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2349106259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2349106259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2349106259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2349106259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2349106259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2349106259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019180037.11e-178PREDICTED: myb family transcription factor PHL7-like isoform X2
SwissprotQ9SJW01e-103PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A061GGR11e-131A0A061GGR1_THECC; Myb-like HTH transcriptional regulator family protein
STRINGEOY290601e-132(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27962451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-78G2-like family protein