PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000339.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family TCP
Protein Properties Length: 119aa    MW: 13853 Da    PI: 10.4209
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000339.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP49.81.3e-1523761871
                      TCP 18 RdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71
                             R+RR+Rl++e  ++fF L + LG+ +++ t eW l+++k+ai +l + ++ +++
  Itr_sc000339.1_g00003.1 23 RGRRIRLPVEFSKEFFGLKKLLGHQRPGLTTEWILENSKAAIEDLRSKKAVNHN 76
                             9********************************************999555553 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136911.725167IPR017887Transcription factor TCP subgroup
PfamPF036341.2E-152378IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MSRKINCRSF KNFRGRRSNC RDRGRRIRLP VEFSKEFFGL KKLLGHQRPG LTTEWILENS  60
KAAIEDLRSK KAVNHNENDV LVPSSCSGEI RFMIDHQGLK RLLPTTECDM EAKTIDMMD