PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000336.1_g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ARF
Protein Properties Length: 840aa    MW: 92889.9 Da    PI: 7.4101
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000336.1_g00026.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.18e-24189290199
                              EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                              f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+++gL +gD v
  Itr_sc000336.1_g00026.1 189 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyKEQ-RPSQELVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKGLVSGDAV 273
                              99****************************86333.45679********************************************* PP

                              EEEE-SSSEE..EEEEE-S CS
                       B3  81 vFkldgrsefelvvkvfrk 99 
                              +F   + +++ l+++++r+
  Itr_sc000336.1_g00026.1 274 LFL--RGEGGDLRLGIRRA 290
                              ***..4489999**99986 PP

2Auxin_resp921e-303504151782
               Auxin_resp  17 PrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                              P as+++F+v+++k++k++++++ vG+Rfkm+++ +ds+err+sG+v+g+sd+dp+rWp+SkWr+L
  Itr_sc000336.1_g00026.1 350 PGASHADFIVPYQKYVKSINNRIPVGTRFKMRYDYDDSPERRFSGIVTGISDMDPYRWPGSKWRCL 415
                              999**************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.4E-44182314IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.3E-40182302IPR015300DNA-binding pseudobarrel domain
CDDcd100172.93E-22187289No hitNo description
SMARTSM010191.5E-23189291IPR003340B3 DNA binding domain
PfamPF023621.1E-21189290IPR003340B3 DNA binding domain
PROSITE profilePS5086313.056189291IPR003340B3 DNA binding domain
PfamPF065077.8E-25350415IPR010525Auxin response factor
PfamPF023093.5E-6704793IPR033389AUX/IAA domain
SuperFamilySSF542771.91E-10705788No hitNo description
PROSITE profilePS5174522.1709793IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 840 aa     Download sequence    Send to blast
MEIDLNHAVS GGVEKKQKNN ASFCNGECEK GGGGGCAYCC LSTSTSSSCS SSNASSSSSA  60
PPSSIYMELW HACAGPLTSL PKKGNVVVYF PQGHLEQAAT SASPFPPSFE MDLPTLALHP  120
QIFCSVQDVQ LLANKENDEV YTKLTLLPIP EPVGMNLEGK EHEDLGIDED GGGGGGGGAA  180
PVKSTSHMFC KTLTASDTST HGGFSVPRRA AEDCFPPLDY KEQRPSQELV AKDLHGVEWK  240
FRHIYRGQPR RHLLTTGWSI FVSQKGLVSG DAVLFLRGEG GDLRLGIRRA ARPRNGLPES  300
IIKNQSSYSS VLSAVTNAVS CKSTFHVFYS LSQVGRTIGL VTTRFQIRLP GASHADFIVP  360
YQKYVKSINN RIPVGTRFKM RYDYDDSPER RFSGIVTGIS DMDPYRWPGS KWRCLMVRWD  420
DDVMSNHQER VSPWDIDSSV SLPPLNIQSS PRMKKLRASQ PALPHESHFS EMEESVRSSK  480
VLQGQENIGL VSPLYGKLNC HPEFEQQTVP RRDFMPAGIE KRKLGELFQT QPPAMYTGFL  540
ESNRFPKVLQ GQEICSLRSL AGKKDMKFGS WAKPEQGCNV FQAYQSPKNN FYHLDSQGMR  600
NNTFLPYNGI YRAGQNPVMF PHMNDYPREN HVLKPISIQN GKRREEGTIQ NFTSEQIPLE  660
KPSKLATPET HFKDEKSDPL SGTGGPCKLF GFSLTKEPST LSSQGSSKRS CTKVHKQGSL  720
VGRAIDLSRL NGYEDLLIEL EKLFGMDGLL RDPNKGWRIL YTDSENDMMV VGDDPWHEFC  780
EVVSKIHIYT QEEVDKMSIG GISDDTQSCL EEAPPITTDA SKSSSVGLPN PNSSPTVSKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_B1e-107544463356Auxin response factor 1
4ldy_A1e-107544463356Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779766.10.0PREDICTED: auxin response factor 4
RefseqXP_016462299.10.0PREDICTED: auxin response factor 4-like
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLQ2LAI90.0Q2LAI9_SOLLC; Auxin response factor
STRINGSolyc11g069190.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51432234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4