PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000325.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CO-like
Protein Properties Length: 360aa    MW: 38437.1 Da    PI: 6.586
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000325.1_g00028.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.62.3e-073374439
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                             + C+ ++   ++ fC+ +  ++C  C ++ H+       H++
  Itr_sc000325.1_g00028.1 33 KPCDYCKATVASVFCRADAAFMCIACDTAVHNAggtagaHER 74
                             68******99*********************76888888876 PP

2zf-B_box26.61.3e-0875120342
                 zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                               ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  Itr_sc000325.1_g00028.1  75 VWVCEVCEQVPASVTCKADAAALCVTCDHDIHSAnplaqrHERVPV 120
                              689*****************************66899999999986 PP

3CCT69.68e-24291334144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea++lRY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Itr_sc000325.1_g00028.1 291 REAKVLRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 334
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.8263077IPR000315B-box-type zinc finger
SMARTSM003362.7E-93077IPR000315B-box-type zinc finger
PfamPF006439.5E-63374IPR000315B-box-type zinc finger
CDDcd000216.30E-83477No hitNo description
PROSITE profilePS5011910.60873120IPR000315B-box-type zinc finger
PfamPF006432.5E-674120IPR000315B-box-type zinc finger
CDDcd000211.52E-876120No hitNo description
SMARTSM003361.7E-778120IPR000315B-box-type zinc finger
PROSITE profilePS5101716.767291333IPR010402CCT domain
PfamPF062031.2E-17291333IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGVGMVESGV GVGLKCFSGG WTAAAAAPNT AAKPCDYCKA TVASVFCRAD AAFMCIACDT  60
AVHNAGGTAG AHERVWVCEV CEQVPASVTC KADAAALCVT CDHDIHSANP LAQRHERVPV  120
TPFYDSAAEA ALKSSAFATN ALPPNPCNAN IDIPIPWNPS KPPLLIPEIK SSTVDLSFSD  180
SDHFLDFDYP ISSLETNNLA QHDSVNDSIV PVQPTKPSAA IANRFDIDFT RPNTKSYNAR  240
SLSHSVSSSS LDAGVVPDGS AASEISYSLG QNVAGGVDLS NTATQLVGKE REAKVLRYRE  300
KRKNRRFEKT IRYASRKAYA ETRPRIKGRF AKRTEVESDI DAIFSADFVA DHGYGVVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019197893.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH81e-96COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A328DYP71e-144A0A328DYP7_9ASTE; Uncharacterized protein
STRINGGLYMA13G01290.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-83CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]