PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000300.1_g00051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 491aa    MW: 55613.6 Da    PI: 5.8386
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000300.1_g00051.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS261.92.2e-801204844374
                     GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevs 88 
                              lL + Ae+v+++++ +a++lL   ++ as +g++++R++ yf++AL++r+     +e+ ++ ++  + e+ + +  aa  + ++  
  Itr_sc000300.1_g00051.1 120 LLQASAEMVANQQFDRARKLLGLCNQSASANGSTVERIVYYFARALKERMDLdRETETEESEKVPLNVEEAVMSMEAAIIACVQDL 205
                              67788*********************************************982333333333333333333444444445599999 PP

                     GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelg 173
                              P+ +++++t  +aIl+ + ++++vH +Df+i+ G +W  ++q La+R+e+p  sl+iT+vgs    sk+++e+tg+ L++fAe+++
  Itr_sc000300.1_g00051.1 206 PFSQVTNFTGVHAILDNITSARKVHLVDFEIGSGSHWTIIMQDLANRSEPPIeSLKITAVGS----SKRRIERTGKWLSSFAETMN 287
                              ************************************************99877*********....******************** PP

                     GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                              +pf+f+++ + + +dl+ e ++++ +E++aV   ++l +ll  + +l++    ++ ++++ +P v+vv+e ead+n++sFl+rf +
  Itr_sc000300.1_g00051.1 288 LPFSFKAI-VCDAKDLRKELFEMEADEVVAVFAEYRLSTLLVCPNQLQN----LIAVIQTFNPSVMVVAETEADTNTPSFLARFYN 368
                              *******5.77799***************************66666666....********************************* PP

                     GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                               l+y++a +ds+++ + r+++ r+  E+++  + i+nv+++ega+r+ rh +   Wr+ + ++G ++ +ls++a  qa+ l+rk++
  Itr_sc000300.1_g00051.1 369 LLSYCTATLDSVATCMDRDHQYRKITEQVIHWELIRNVITTEGADRIYRHAKIDFWRQFFARFGIEEEALSHSALYQASFLIRKYP 454
                              *****************************99999**************************************************** PP

                     GRAS 346 .sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +   +++ + +s+++ Wk+ p+ s+S+W+
  Itr_sc000300.1_g00051.1 455 sWSHCSLDMNGKSMIIKWKGTPVKSLSVWK 484
                              7777999999*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.59891463IPR005202Transcription factor GRAS
PfamPF035147.8E-78120484IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MSVEIRKNRD NQPLEDDSVV VAESKREQPS ESSLQILQRY WSDLMHGGGK KMNTIRIDKP  60
SNSSAAVQMV LSPEEIMQIA RSKLEQCAFQ SCCVHSVVFE HSYLLGETDI KGGDVELALL  120
LQASAEMVAN QQFDRARKLL GLCNQSASAN GSTVERIVYY FARALKERMD LDRETETEES  180
EKVPLNVEEA VMSMEAAIIA CVQDLPFSQV TNFTGVHAIL DNITSARKVH LVDFEIGSGS  240
HWTIIMQDLA NRSEPPIESL KITAVGSSKR RIERTGKWLS SFAETMNLPF SFKAIVCDAK  300
DLRKELFEME ADEVVAVFAE YRLSTLLVCP NQLQNLIAVI QTFNPSVMVV AETEADTNTP  360
SFLARFYNLL SYCTATLDSV ATCMDRDHQY RKITEQVIHW ELIRNVITTE GADRIYRHAK  420
IDFWRQFFAR FGIEEEALSH SALYQASFLI RKYPSWSHCS LDMNGKSMII KWKGTPVKSL  480
SVWKFCPVKN N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3414048426375GRAS family transcription factor containing protein, expressed
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019174204.10.0PREDICTED: scarecrow-like protein 23
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.15e-46RGA-like 2