PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000284.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family WOX
Protein Properties Length: 239aa    MW: 26598.7 Da    PI: 7.6786
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000284.1_g00020.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.8e-201675357
                             --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                             +R+++tkeq++ Le+++++  r+p+ae++++++  l    +++ ++V++WFqN++a++++
  Itr_sc000284.1_g00020.1 16 SRWNPTKEQINLLESFYNQgIRTPTAEQIQQITGMLrafgHIEGKNVFYWFQNHKARQRQ 75
                             7*****************99**************************************97 PP

2Wus_type_Homeobox111.93.4e-361577365
        Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                              +RW+Pt+eQi++Le+ y++G+rtP++e+iq+it +L+++G+ie+kNVfyWFQN+kaR+rqkq
  Itr_sc000284.1_g00020.1 15 GSRWNPTKEQINLLESFYNQGIRTPTAEQIQQITGMLRAFGHIEGKNVFYWFQNHKARQRQKQ 77
                             68***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.7381176IPR001356Homeobox domain
SuperFamilySSF466892.87E-121182IPR009057Homeodomain-like
SMARTSM003892.8E-51380IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.1E-81675IPR009057Homeodomain-like
PfamPF000461.4E-171675IPR001356Homeobox domain
CDDcd000863.37E-71777No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MEDVNMMTTN TGSNGSRWNP TKEQINLLES FYNQGIRTPT AEQIQQITGM LRAFGHIEGK  60
NVFYWFQNHK ARQRQKQKQE NLAFFNHFHY PYPHPHHHLY LQHCPNVMYR PYYVPPQGDL  120
GFYAKSPGLF LSAGSTTGYK RNAQKMEIMH KPSPPIGDEE SNTASVKCSP ETLDLFPLLP  180
TGILQASKSV NGVSGDAPSS GSVEINCCGD EHRGGGGGGS AGDHPFFDFF CGNGRYGAH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019199133.11e-154PREDICTED: WUSCHEL-related homeobox 2
TrEMBLA0A484ND774e-67A0A484ND77_9ASTE; Uncharacterized protein
STRINGXP_002531361.13e-57(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.14e-37WUSCHEL related homeobox 2