PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000283.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 273aa    MW: 30889.9 Da    PI: 7.5622
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000283.1_g00012.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.3e-312074155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprl+Wt eLHe Fv+av+qLGG++kAtPk+++++m++ gL+l+h+kSHLQkYR 
  Itr_sc000283.1_g00012.1 20 KPRLKWTAELHETFVDAVQQLGGADKATPKSLMKAMNIRGLSLYHLKSHLQKYRH 74
                             79****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-281774IPR009057Homeodomain-like
PROSITE profilePS5129410.1281777IPR017930Myb domain
SuperFamilySSF466892.15E-151974IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-222075IPR006447Myb domain, plants
PfamPF002494.8E-82273IPR001005SANT/Myb domain
PfamPF143799.5E-21112157IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MAPQSVQGNA MSLVLSREAK PRLKWTAELH ETFVDAVQQL GGADKATPKS LMKAMNIRGL  60
SLYHLKSHLQ KYRHGKSHQS RHSCPTRQQE KNLQSLSEDC TNSGLCGFRE LQISRALQVQ  120
MEVQKTIHEQ IEVQRHLQLR IEAQGKYLQS ALKKAQEILS KAEISLLISP NMVDLGCQSS  180
SESGLTTEAG HPTLKDKENS EPMTTLESCE REEETVENPS DKKRFRGRRY DDNETLKSSS  240
GLLENLDLNV KSTVNKFDDT TECKVIDLNR EWV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-181976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-181976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-182076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-182076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-182076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-182076157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-181976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-181976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-181976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-181976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-181976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-181976158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019170620.11e-134PREDICTED: myb family transcription factor PHL8-like isoform X3
SwissprotF4I2741e-53PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLA0A1P8C4J02e-66A0A1P8C4J0_9ROSA; MYB11
STRINGXP_008339891.18e-70(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60361932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.23e-57G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]