PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000261.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 501aa    MW: 54849.1 Da    PI: 5.3664
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000261.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1054.5e-33291345155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+lmkv+ Lt++hvkSHLQkYR+
  Itr_sc000261.1_g00001.1 291 KQRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLMKVDHLTIYHVKSHLQKYRT 345
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.608288348IPR017930Myb domain
SuperFamilySSF466895.2E-18289345IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-30290347IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-25291345IPR006447Myb domain, plants
PfamPF002491.8E-9293344IPR001005SANT/Myb domain
PfamPF143798.7E-26376423IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MEARPALSIQ RVGSRQLNNF GASGALSSSL PVLPTNLEGK YPKLPDSQQI SLERETMQCP  60
PAVAPLSSNS EVAGLMFSSS SGFSSDLHFS SASPLEKHSR QPPFISQSTN NESSMLLPDS  120
GVLQSTASSH YSKENIGPWS TDSLTDFLDY PINTPAHSGQ LQCSNNADCA ITSEDLGKRN  180
DWQEWADQLI TDDDALAANW SDIIADTSTA DPKPKRKPSH ESNLFFSSVL SDASAVVLAF  240
GKMLQVQYQV SKQSSNLQIQ QSQASQQLVA FPEETSATVP LSSSAGAAPT KQRMRWTPEL  300
HEAFVEAVNK LGGSERATPK GVLKLMKVDH LTIYHVKSHL QKYRTARYKP ESSEASSEKK  360
QSAIDDFPSL DLKAGIEITE ALRLQMEVQK RLHEQLEIQR NLQLRIEEQG RYLQMMFEKQ  420
CKSMPNIDMG KGSSPTSENP IAQLTDGVQT SPGKSDPVAN HPKTGDNDSE TREEKQKECE  480
TGEVPAASSE SPPPSKRTKV D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-30291349260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-30291349260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-30291349260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-30291349260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-30291349260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-30291349260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-30291349260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-30291349260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019165542.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_019165550.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A1U7WMW60.0A0A1U7WMW6_NICSY; protein PHR1-LIKE 1-like isoform X1
STRINGXP_009781296.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.27e-84G2-like family protein