PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000257.1_g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family bZIP
Protein Properties Length: 188aa    MW: 21763 Da    PI: 7.0556
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000257.1_g00040.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.71.7e-1597155563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              +r+rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L  +l++  +  +++ +e+
  Itr_sc000257.1_g00040.1  97 RRQRRMISNRESARRSRMRKQKHLDELWSQVNWLRNENQQLLGKLNHVAESHEQVVQEN 155
                              79*********************************************999999887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-1593157IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.90995158IPR004827Basic-leucine zipper domain
PfamPF001707.1E-1397154IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-1297169No hitNo description
SuperFamilySSF579593.31E-1397151No hitNo description
CDDcd147022.62E-2098148No hitNo description
PROSITE patternPS000360100115IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MQPSDENTQF FTHNLLPSNP NHQYYYPPAH HFASSSTNNT TTSAFHHLTR FPNNHPALHQ  60
MAHQLQDFNN PPAACFISSS GASTSDEAEE QQLMNERRQR RMISNRESAR RSRMRKQKHL  120
DELWSQVNWL RNENQQLLGK LNHVAESHEQ VVQENVHLKE EASELRQILT TGIPHIININ  180
DPTYPAAL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109116RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019195076.12e-67PREDICTED: basic leucine zipper 8
TrEMBLA0A4D9BU754e-50A0A4D9BU75_SALSN; Uncharacterized protein
STRINGVIT_14s0083g00700.t011e-47(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-42basic leucine-zipper 42