PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000253.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 345aa    MW: 38036.1 Da    PI: 6.6417
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000253.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.83.9e-31215270156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rF++a+++LGG+++AtPk+i ++m v+gLt+++vkSHLQkYRl+
  Itr_sc000253.1_g00008.1 215 KQRRCWSPELHQRFIDALDKLGGAQVATPKQIIDIMRVDGLTNDEVKSHLQKYRLH 270
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.29212272IPR017930Myb domain
SuperFamilySSF466899.86E-17213273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28213273IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-25215270IPR006447Myb domain, plants
PfamPF002491.5E-6217268IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGPDGRKLSI DLNSEFGVPK TISDCLAEVS ATGDVSLKSS KLSCFLQALE EELRKIDAFR  60
RELPLSMQII NLAIEKVKEE VLQVKRKEKG PVMEEFLPLK GDSDEEGRGA KRSNDESDKK  120
NWMNSATLWN NPVRNSVEDD DVQFRSGEFK NEGGAFQPYK RIAAAVKVEE AAEKAALPIN  180
VLPVACERGR VSIDLHLKSG GGGGGSRNGP PQGKKQRRCW SPELHQRFID ALDKLGGAQV  240
ATPKQIIDIM RVDGLTNDEV KSHLQKYRLH VRRLPSHPPP PFSSAEQRSD ALKVAKMAAQ  300
SGSPEGPLHL SGSGKEISMT LTNIPEEEEE DEISESSWKK QGHIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14215268255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14215268255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-14215268154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-14215268154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-14215268154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-14215268154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14215268255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14215268255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14215268255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14215268255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14215268255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14215268255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019185192.11e-176PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A1S4BGB33e-95A0A1S4BGB3_TOBAC; uncharacterized protein LOC107807956
TrEMBLM1AMN52e-95M1AMN5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000260964e-96(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA84972229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-55G2-like family protein