PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000246.1_g00031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 476aa    MW: 52061 Da    PI: 5.2293
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000246.1_g00031.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.85.8e-34267321155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              kpr+rWtpeLHe Fveav++LGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Itr_sc000246.1_g00031.1 267 KPRMRWTPELHEVFVEAVNKLGGSEKATPKGVLKLMKVEGLTIYHVKSHLQKYRT 321
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.65264324IPR017930Myb domain
SuperFamilySSF466891.52E-18265321IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-31266323IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-25267321IPR006447Myb domain, plants
PfamPF002497.9E-10269320IPR001005SANT/Myb domain
PfamPF143791.3E-23353399IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MMNARIQRSS EAQHSNVGVS AAMSTPLPIL PSIEEKFPKL PGPLQVNHDH ERMVHPLSSR  60
MNTSASNGGT LGHPTSSSSG LQKDLHISPQ ENKSRNYPFI SNSSIDGPSL ASSHSGIQSS  120
ALDSYPVGNG IDSWSKDECR DFLDYTTSIP VQNGQVETVA GVMSSDDHAK RTDWQEWADQ  180
LINDDDTLAG TSWSDILIDV DVPDPEPKGV GLSFSGGAAV SFTLCASLLL PSPDVHVPRP  240
QTLQQTPALS EQNFAVASPS SAAALTKPRM RWTPELHEVF VEAVNKLGGS EKATPKGVLK  300
LMKVEGLTIY HVKSHLQKYR TARYKPEPSE GTSETKPASV PEEAASLDMK TTMGITEALR  360
LQMEVQKQLH EQLEIQRKLQ LRIEEQGKYL QMMFEKTRNM GKELKASDDE PPLSPPNDNQ  420
QLPDQDNANS ELGSSNKTPE PSSQERNACE PHDSAGKDFD SPQRKRAKVD ETTAPQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-31267325260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-31267325260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-31267325260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-31267325260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-31267325260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-31267325260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-31267325260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-31267325260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019198515.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 1-like
RefseqXP_019198516.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 1-like
TrEMBLA0A0V0ICE00.0A0A0V0ICE0_SOLCH; Uncharacterized protein
STRINGXP_009775047.11e-179(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.16e-92phosphate starvation response 1