PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000229.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 345aa    MW: 38304.3 Da    PI: 10.0003
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000229.1_g00016.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.1e-32159212255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt++LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Itr_sc000229.1_g00016.1 159 PRMRWTTTLHARFVNAVDLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 212
                              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.48E-15156212IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-28157212IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-24159212IPR006447Myb domain, plants
PfamPF002498.0E-7160211IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MELFPAQPDL SLRISPPNAN KPSSSPWTAS KAQEHQRGDV MDLSFWKRAL GPRNSESAIN  60
AVSSSSSSFE LSLSNQWPEH NGNSNGGNNF VQFQYSHPQV GLGSEIGFLR PIRGIPVYSQ  120
NPPSSPSSSS SQSHRHHQPL MRSRFLPARF PARRSMRAPR MRWTTTLHAR FVNAVDLLGG  180
HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDKSA VAASSGQSEI FDNGSSGDTS  240
EDVQTSRKSE LSVQKGTQNM HNQEKDYNGL WCNVSSSRES WLHGNPSDSR GSTPFPTEND  300
KDPRWLGYER MSAEMNSSSN TTTTTMETRS NKPNLEFTLG RPSGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-16160214357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16160214357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16160214357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16160214357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019162634.11e-177PREDICTED: probable transcription factor KAN2 isoform X1
RefseqXP_019162635.11e-177PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6162e-82KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A1S3Z5E61e-115A0A1S3Z5E6_TOBAC; probable transcription factor KAN2 isoform X3
STRINGVIT_02s0012g01940.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-50G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]