PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000214.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 478aa    MW: 52780.4 Da    PI: 6.8797
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000214.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like35.22.8e-1186109225
                  G2-like   2 prlrWtpeLHerFveaveqLGGse 25 
                              prlrWtp+LH +Fv+ave LGG++
  Itr_sc000214.1_g00008.1  86 PRLRWTPDLHLCFVHAVETLGGQD 109
                              8*********************98 PP

2G2-like48.91.4e-151511842255
                  G2-like  22 GGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              G +  AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Itr_sc000214.1_g00008.1 151 GKESGATPKLVLQLMNIKGLSIAHVKSHLQMYRS 184
                              33456****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-2782110IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-10148186IPR006447Myb domain, plants
SuperFamilySSF466899.68E-5149185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-27156185IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MKGGISCSPE DFSNKSPETQ IEEDLKDEEQ EDDEYEEEEE GEEEGISEKG KGNNGSSSSN  60
STVEENGKKA GNSSGSVRQY VRSKTPRLRW TPDLHLCFVH AVETLGGQDS MCSQLSSPFF  120
SFLHLLFSIP PFLATTRGYA LNKFRLVTLA GKESGATPKL VLQLMNIKGL SIAHVKSHLQ  180
MYRSKKMDDL NQAVTSSNGR LLLDNGDHHH FFNFGHLQRL QGFNQTTNPT VRFQDALRSH  240
QANAIYNPYI NGGASSMIRH GGLHGIFGGN IYGSHNNNNN VNSNHSHHNN PLSSDYFRTA  300
AAISRQSPAC KNMENENKLH QPHFFPAQRI LASHQFGIGS SPANQILLKK LQLERGRDPP  360
PAPAPPPQTR NILEESVGVS RPDGAAAEGT HTLKRKSLPD SSCDRHQVNL DLSLSLRTRN  420
ENDQKRLKLD EEDAGEYDVG GVDTTDLSLS LFSSSSEKHH GTTKQPTRIE NSGLHLSL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU1716163e-84GU171616.1 Ipomoea batatas microsatellite Stv_Ipb_318 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019150906.10.0PREDICTED: uncharacterized protein LOC109147717 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85732129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.16e-27G2-like family protein