PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000176.1_g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family TCP
Protein Properties Length: 281aa    MW: 30703 Da    PI: 9.6338
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000176.1_g00029.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP94.22.6e-2968136270
                      TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                               g+kdrhsk++T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl +ak  i++l+ ++ ++ 
  Itr_sc000176.1_g00029.1  68 FGGKDRHSKVCTVRGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLDAAKGDIDQLPPLQIPPR 136
                              689*************************************************************66555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.4E-2770132IPR005333Transcription factor, TCP
PROSITE profilePS5136930.45570128IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MITREVDFCN AGTRQEGDKS SDVKVNLHGK TVTVAGFSAS RPTTSSSTST TSWTRLKDPR  60
IVRVSRAFGG KDRHSKVCTV RGLRDRRVRL SVPTAIQLYD LQDRLGLNQP SKVVDWLLDA  120
AKGDIDQLPP LQIPPRIFDP FLAAPPSTAV SAVSTPPPLT SFLRWDPSPP PQKQELDHFH  180
TFNNAVLSSP SLPPSAAVSS QVLVCPPPGL QPYSFLHHPA ASPPELDLKQ IINFQMLMSS  240
NSQPPFSTSL QPPPPPPLVI KPMHFLHSHH AGAPPDKNEE P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A5e-1875129155Putative transcription factor PCF6
5zkt_B5e-1875129155Putative transcription factor PCF6
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019185198.11e-135PREDICTED: transcription factor TCP5-like
RefseqXP_019185199.11e-135PREDICTED: transcription factor TCP5-like
TrEMBLA0A1S3XAZ71e-57A0A1S3XAZ7_TOBAC; transcription factor TCP13-like
STRINGXP_009623901.12e-58(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.14e-46plastid transcription factor 1