PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000156.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Dof
Protein Properties Length: 278aa    MW: 30383 Da    PI: 6.9869
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000156.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.32.2e-3551108260
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                              k + lkcprC s+ntkfCyynny+ sqPr+fCk+C+r+Wt+GG+lrnvPvGg+ rknk+
  Itr_sc000156.1_g00005.1  51 KAEPLKCPRCASENTKFCYYNNYNKSQPRHFCKGCKRHWTEGGTLRNVPVGGS-RKNKR 108
                              56889*********************************************976.66665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.4E-3154107IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2255108IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.80455109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGLSTKQVSG GDHHHHQHGI IEWENPQTPG GSTRLDLPTV QPQSVQPQPQ KAEPLKCPRC  60
ASENTKFCYY NNYNKSQPRH FCKGCKRHWT EGGTLRNVPV GGSRKNKRLK TPPNPTAVKS  120
SSPPAATCDN QKPVFSGENK NHAPSLFFPA AIQADPVIGA AAAAFNIGST PTMVLHDDQD  180
TTKLLPFSFS SFFDPISCSI PSFNTQSSSN NAYSDIIVGE LDNVEESTIT TVMPFTSSAV  240
ISQPWDMANY WSLSEIDSLV SADLNIPWDD LEIKPKGK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780420.17e-60PREDICTED: dof zinc finger protein PBF-like
RefseqXP_016445863.16e-60PREDICTED: dof zinc finger protein PBF-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.15e-30Dof family protein