PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000113.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Dof
Protein Properties Length: 269aa    MW: 29391 Da    PI: 5.0945
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000113.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.42.3e-362380461
                   zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                             + lkcprCds +tkfCyynnys sqPryfCk+CrryWtkGGalr +PvGgg+r++k +
  Itr_sc000113.1_g00005.1 23 RRLKCPRCDSPDTKFCYYNNYSQSQPRYFCKTCRRYWTKGGALRTIPVGGGCRRRKIM 80
                             6789**************************************************9966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.1E-312478IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.1832579IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-242578IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAAANKGDAQ ISGDGDKTPA VTRRLKCPRC DSPDTKFCYY NNYSQSQPRY FCKTCRRYWT  60
KGGALRTIPV GGGCRRRKIM KSSPAARYYD IGGLGYLNGV SQPLGGIKIP SYNTSAAALI  120
NQLSGALLAM PSTPPCFNLD QLSPPFSISS PLFDFKFPGT QELGRLAPPI EPVGTANQDL  180
QWNLQQKILE KQILEIPTPP SEATFESTSS RIAEATEWLF DDDDVTFPLP GNPTATNSFG  240
NGNGNASEDD WDELIQAWAT NFNEFSALP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019177185.11e-109PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLA0A328DF808e-52A0A328DF80_9ASTE; Uncharacterized protein
STRINGXP_002532379.15e-49(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-31TARGET OF MONOPTEROS 6