PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000100.1_g00027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 418aa    MW: 47074.3 Da    PI: 8.3694
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000100.1_g00027.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like361.6e-11260289130
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPk 30 
                              k+r++W+p+LH+rF++a++qLGG++    +
  Itr_sc000100.1_g00027.1 260 KQRRCWSPDLHKRFINALQQLGGPQGCSIR 289
                              79*********************9966544 PP

2G2-like521.6e-163163462656
                  G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              +AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Itr_sc000100.1_g00027.1 316 VATPKQIRELMQVEGLTNDEVKSHLQKYRLH 346
                              79***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-26257285IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-7260285IPR006447Myb domain, plants
SuperFamilySSF466897.77E-7315349IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-13316346IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-26317350IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MDFISPLDSR PPVVLRTITE FLREISMIGN VSEKVERIDD RVRRLEDEMR KIDAFKRELP  60
LCMVLLNDVI IVLKEESKKC RKSLVEPVFE EFLPLKKSSG DDDLDRHYKV ETNKEDTKEK  120
INWVSSLQLW NGDSGCSHSD RSNNKHSLEY DLRMSAEGEG NSSVANDFPM SFKRRNINKA  180
FVPFKGCSGF PVKVVRKDHQ EELPGEPGLS LSTPGITNRR EDMVIGDFSS KPSRVVPSSA  240
SSTVTNIKAR AQPQQQTSRK QRRCWSPDLH KRFINALQQL GGPQGCSIRQ LIAAESVKTI  300
SMVVKPEMHP FWFFAVATPK QIRELMQVEG LTNDEVKSHL QKYRLHTRRI PTTQSSPANK  360
SIVVLGNLFP VDEYGESSKQ SSSQSGSPQG TLQLAASSRG TSMTGSDSME EDGDDRSE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019165310.10.0PREDICTED: myb family transcription factor EFM-like isoform X1
TrEMBLA0A0V0I6V01e-126A0A0V0I6V0_SOLCH; Putative two-component response regulator-like APRR2-like
STRINGSolyc01g108300.2.11e-125(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-46G2-like family protein