PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000092.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 514aa    MW: 56897.3 Da    PI: 5.6946
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000092.1_g00018.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32312366155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              kpr+rWtpeLHe+F+eav++L G+ekAtPk++l+lm+v+gLt++hvkSHLQkYR+
  Itr_sc000092.1_g00018.1 312 KPRMRWTPELHECFMEAVKKLDGAEKATPKAVLKLMNVEGLTIYHVKSHLQKYRV 366
                              79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.227309369IPR017930Myb domain
SuperFamilySSF466891.97E-17310366IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-30311367IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-25312366IPR006447Myb domain, plants
PfamPF002491.6E-9314365IPR001005SANT/Myb domain
PfamPF143791.4E-21402449IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MGSVLKLEGW FVSESCRRGE FSPSPRYDLA IGSFWVIKDV ALYVAVDISQ LMCLCCWVVN  60
YMFLPGKHPE LGDEVSESYC TTESDIHNVS SGELGQQLLA DDCSSGSAPH NLSDFLHKCT  120
EQSPIVSPTP GQCSSFSSAS HVQQPQNQFS RSSMFCTSLH LSSSSSLETT LRLGSLPFLP  180
DPSPHRLPKN FTIQSSDSPL HVQSDEGASE ASLKILQNIL LDESDGSVNH GHCEINDLQL  240
TEQMELQLLS DELDIAIGGD VENPRIDEIY EEPQALIQQS RELTPSQNFV SCTLPTDKLS  300
VQPSSGPAAL HKPRMRWTPE LHECFMEAVK KLDGAEKATP KAVLKLMNVE GLTIYHVKSH  360
LQKYRVAKYM PERTEEKKTS SSEDKKATVI GKGSEGKKKG NIQVMEALRM QMEVQKQLHE  420
QLEVQRALQL RIEEHARYLQ KILEEQQKAG CRVPAPLQTG SCADSEPRLA SSPMSVSPSS  480
DVASTKLEAD DGGGSLNMKR HKKDRVQPTQ NHLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-25312369259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-25312369259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-25312369259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-25312369259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-25312369259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-25312369259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-25312369259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-25312369259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019197003.10.0PREDICTED: myb family transcription factor PHL6-like
SwissprotQ949U21e-101PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A484KC781e-174A0A484KC78_9ASTE; Uncharacterized protein
STRINGVIT_09s0054g01620.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2152022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.25e-81G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]