PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000088.1_g00031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 291aa    MW: 33029.1 Da    PI: 6.5063
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000088.1_g00031.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.53.7e-51101381129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat+sgyWkat
  Itr_sc000088.1_g00031.1  10 LPPGFRFYPSDEELVCHYLYKKIANEEVLK-GTLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRTNRATTSGYWKAT 94 
                              79*************************655.78***************87788899****************************** PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkd++v++  +++ vg++ktLvfy++rap+g+kt W+mhe+rle
  Itr_sc000088.1_g00031.1  95 GKDRTVMDPrSQAIVGMRKTLVFYRNRAPNGVKTGWIMHEFRLE 138
                              ********9555669**************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-618156IPR003441NAC domain
PROSITE profilePS5100558.19810156IPR003441NAC domain
PfamPF023658.5E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KIANEEVLKG TLVEIDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV MDPRSQAIVG MRKTLVFYRN  120
RAPNGVKTGW IMHEFRLENP HIPPKEDWVL CRVFHKSKGE TSENNNLNTC MYDNSIVLPA  180
ATSPPSLAAS PPNMDAASFP YRPIAAAACQ NQSATTAAAA NFFNVSLSVP EHHHNGFLRS  240
SHEMPHSNKC ETDQYGFLFD MNFEEPNFHD GGVHSSLDDM RFDDENGMVF I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-47915716166NO APICAL MERISTEM PROTEIN
1ut4_B6e-47915716166NO APICAL MERISTEM PROTEIN
1ut7_A6e-47915716166NO APICAL MERISTEM PROTEIN
1ut7_B6e-47915716166NO APICAL MERISTEM PROTEIN
4dul_A6e-47915716166NAC domain-containing protein 19
4dul_B6e-47915716166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019161635.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE61e-64NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A2G2X5W61e-138A0A2G2X5W6_CAPBA; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A2G3CVA51e-138A0A2G3CVA5_CAPCH; Protein CUP-SHAPED COTYLEDON 3
STRINGXP_009800923.11e-138(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.19e-93NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]