PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000060.1_g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 333aa    MW: 36746 Da    PI: 8.0229
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000060.1_g00030.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.6e-314497255
                  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             prlrWtp+LH++F++a++ LGG++kAtPk +l+lm+v++Lt++hvkSHLQ+YR+
  Itr_sc000060.1_g00030.1 44 PRLRWTPDLHNCFLHAINALGGQHKATPKLVLQLMNVPDLTISHVKSHLQMYRS 97
                             8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-304098IPR009057Homeodomain-like
PROSITE profilePS512949.79340100IPR017930Myb domain
SuperFamilySSF466892.33E-154298IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-234498IPR006447Myb domain, plants
PfamPF002491.9E-74596IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGSCGRSSGV RQYVRSKVPR LRWTPXGSCG RSSGVRQYVR SKVPRLRWTP DLHNCFLHAI  60
NALGGQHKAT PKLVLQLMNV PDLTISHVKS HLQMYRSMKP DLSDQVEEEK TKQPFVDVRT  120
AAAQAQAQDY HHYHLSSSSP SSSSSLVFLN PSPLPSKRGG ATEESTSWTK VGKGREKRRI  180
IMCEGEGEGE GEEEGCCLFC GLNKNENPPS YFCNVKDSTA AQCPNHSTTL TSLTHQELDF  240
FKVVEGGGEE EKWKTSKKRK RESEEEKDEE GCRLSLSLSI LPLQSTQTSN NNASSTSEIS  300
EAAAISSCSN PNPNFGLLLN PPILNLDLSL CTQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-174599357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-174599357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-174599357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-174599357Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019171281.11e-132PREDICTED: uncharacterized protein LOC109166849
RefseqXP_019171282.11e-132PREDICTED: uncharacterized protein LOC109166849
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.13e-30G2-like family protein