PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000059.1_g00024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 525aa    MW: 58453.7 Da    PI: 5.8554
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000059.1_g00024.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2491.9e-761425172374
                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                              ++lL  cA a+++g+++++q+lL  lselas +gd+++Rlaa+ ++AL ++l + +s+ +    +++ ++++ +    +l +f+++
  Itr_sc000059.1_g00024.1 142 EQLLNPCAAAITAGNMNRVQHLLYVLSELASLTGDANHRLAAHGLQALTHHLGS-GSSFA---GVTTFASTTKKFFRESLMIFNDI 223
                              689*************************************************99.44444...3333333346666677788**** PP

                     GRAS  88 sPilkfshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.......skeeleet 161
                               P++++ +  aN+ Il+a++++    +++Hi+D+++s+G+QWp+Ll++L+ Rp ++pp +R+T+v +   +               
  Itr_sc000059.1_g00024.1 224 NPWFRIPNSFANSSILQALAEQqdrpRCLHILDIGVSHGIQWPTLLEELTHRPgGPPPLVRLTVVTPTVDNqqstpflIPPPGYDF 309
                              *******************9998888899************************55566******9986555555677766777899 PP

                     GRAS 162 gerLakfAeelgvpfefnvlvakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe 245
                                +L  fA+++++++++n+l    l++l  + ++++ +++E l+V+ +++lh+l    ++ ++er+e+Lk +++l Pk vv++e++
  Itr_sc000059.1_g00024.1 310 SPNLLGFAKAININLQINILDNLPLQNLiaHAQSIKSSQDEILIVCAQFRLHNLN---HHAPDERTEFLKSLRNLAPKRVVLSENN 392
                              9******************96668887766889999999***************8...66677789******************99 PP

                     GRAS 246 adh...nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvp 328
                              a++   n ++F+++f++ +ey + +++s+++ +    + r + Er++++ e+ +++ + g++    +e++ekW er++ +GF   +
  Itr_sc000059.1_g00024.1 393 AECscsNCGDFAAGFSRRVEYLWRFLESTSMAF----KGRWNEERRMMEGEAAKALINTGEM----NERKEKWCERMRGVGFAREE 470
                              655337888********************9996....8888889999999999999999999....78888*************** PP

                     GRAS 329 lsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              ++e+a + a++llrk++ +++++vee++g++ l Wk++pL ++S W+
  Itr_sc000059.1_g00024.1 471 FGEDAIDGARMLLRKYDnNWEMKVEEKDGCVDLWWKGQPLSFTSLWK 517
                              *****************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.576115496IPR005202Transcription factor GRAS
PfamPF035146.6E-74142517IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MTIDEPAEPR PFTDQILEWF DSSFLDCPYD SNDHFFGDSW WGDQGQSLEI LHKSDDNGGG  60
VSTSLNSFSS VTTAVEAPVV LDHPAALPPV DRKRKGREEG EAEVEVEQAA APVRKGGGNK  120
KGGSKGGGNS NSNGNKDGRW AEQLLNPCAA AITAGNMNRV QHLLYVLSEL ASLTGDANHR  180
LAAHGLQALT HHLGSGSSFA GVTTFASTTK KFFRESLMIF NDINPWFRIP NSFANSSILQ  240
ALAEQQDRPR CLHILDIGVS HGIQWPTLLE ELTHRPGGPP PLVRLTVVTP TVDNQQSTPF  300
LIPPPGYDFS PNLLGFAKAI NINLQINILD NLPLQNLIAH AQSIKSSQDE ILIVCAQFRL  360
HNLNHHAPDE RTEFLKSLRN LAPKRVVLSE NNAECSCSNC GDFAAGFSRR VEYLWRFLES  420
TSMAFKGRWN EERRMMEGEA AKALINTGEM NERKEKWCER MRGVGFAREE FGEDAIDGAR  480
MLLRKYDNNW EMKVEEKDGC VDLWWKGQPL SFTSLWKMDP NHGFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-3413551781473Protein SHORT-ROOT
5b3h_B8e-3513551727419Protein SHORT-ROOT
5b3h_E8e-3513551727419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019196358.10.0PREDICTED: nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A314KR120.0A0A314KR12_NICAT; Nodulation-signaling pathway 1 protein
STRINGXP_009600029.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-129GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]