PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000023.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRF
Protein Properties Length: 510aa    MW: 54629.5 Da    PI: 6.2991
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000023.1_g00016.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.42.5e-23191234245
                      WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                               epgrC+RtDGKkWRCs++v  ++k+CErHlhrgr rsrk++e+
  Itr_sc000023.1_g00016.1 191 LEPGRCKRTDGKKWRCSKEVALNQKYCERHLHRGRPRSRKPVED 234
                              69***************************************997 PP

2QLQ53.76.5e-19127160235
                      QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                              +FT aQ+ +L++Q+++yKy++a++PvPp+Ll+++
  Itr_sc000023.1_g00016.1 127 PFTCAQWKELERQAMVYKYMMASVPVPPDLLLPL 160
                              8*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.4E-11126162IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.3E-13127160IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.719127162IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.184190234IPR014977WRC domain
PfamPF088793.5E-19192233IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MENGAAGGGV NGFGFPDKET AAGAAAAAES FRPENNNIMM GRHVHHHHHH DGFDGGGSGG  60
GGAGPTGGAN ENSIYMYGDD VATAPPFTVG GGGGAAVALR FSQAFNCSNT APLPFKSPGM  120
ATSLGFPFTC AQWKELERQA MVYKYMMASV PVPPDLLLPL PTDAYNAAPP SFHVQSGGSG  180
GVGFSGKNRD LEPGRCKRTD GKKWRCSKEV ALNQKYCERH LHRGRPRSRK PVEDANNNNK  240
KTRLQQQQQP PLESPPSMVV SQQPANPAPL SSDKHKEAPQ CLDSRMDQSF SISPFNEPHR  300
SLDWEMGGTE EQWKQLMSLE SNVYRENAQN LQQMSLFHCK DYYGSIRQNG ECNLYFNPDL  360
GSLNKEFINA WANGSIANNS NTNTDYALSL AMAAGNILDS EMGVEDGNAG GNCDEEHTMC  420
GNLTLRSPVS WVPFASGGPL AEVLKPSQQL HHPSSSSYIS NGDSISPAGT TVSSPSGVLQ  480
KTNLFSQSDG SVCNSPTVAA SELVPFQWLS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019200415.10.0PREDICTED: growth-regulating factor 7
TrEMBLA0A1J6ISR11e-107A0A1J6ISR1_NICAT; Growth-regulating factor 7
STRINGXP_009597554.11e-114(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-29growth-regulating factor 7