PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000019.1_g00038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 216aa    MW: 24568.7 Da    PI: 6.9613
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000019.1_g00038.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.4e-322578255
                  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             prlrWt+eLH+rFv+ave+LGG+e+AtPk +l+lm+vk +t++hvkSHLQ+YR+
  Itr_sc000019.1_g00038.1 25 PRLRWTEELHRRFVHAVERLGGEERATPKLVLQLMDVKEITIAHVKSHLQMYRS 78
                             8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.5692181IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-312180IPR009057Homeodomain-like
SuperFamilySSF466891.08E-162379IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-242579IPR006447Myb domain, plants
PfamPF002493.2E-82677IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MRVSPENSRL PASGCTRTYA RSKAPRLRWT EELHRRFVHA VERLGGEERA TPKLVLQLMD  60
VKEITIAHVK SHLQMYRSMK HEQKMKETRV EQNYLVSSRT PYNYPNPPHY SGQEEAMPPS  120
FLPTLWQEEG PTIMFMDVLN GSNVQGIIRN DDGNMEEVAD ATMGYYANKF SAATSVTTKN  180
YAHEESASTM SFSSHIKACS DSEPSYNNLF LDLTLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-172681459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-172681459Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-172681358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-172681358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-172681358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-172681358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-172681459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-172681459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-172681459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-172681459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-172681459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-172681459Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019170413.12e-73PREDICTED: uncharacterized protein LOC109165929
TrEMBLA0A2G3D7642e-38A0A2G3D764_CAPCH; Putative transcription factor RL9
STRINGXP_009782820.18e-39(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74502029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-28G2-like family protein