PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000017.1_g00043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 218aa    MW: 24416.8 Da    PI: 5.6979
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000017.1_g00043.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like833.2e-263384455
                  G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             ++Wtp+LH+rF++ave LGG++ AtPk+i++lmk k+Ltl++v+ HLQ+YR+
  Itr_sc000017.1_g00043.1 33 IKWTPDLHRRFLNAVEFLGGEQSATPKAIMDLMKEKDLTLSQVAGHLQMYRS 84
                             69*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.3E-133284IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-233384IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-233384IPR006447Myb domain, plants
PfamPF002491.1E-53483IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MSKQSSPERN QQLRPSSMAE NPLLSSSSSS RVIKWTPDLH RRFLNAVEFL GGEQSATPKA  60
IMDLMKEKDL TLSQVAGHLQ MYRSFCFAQQ QATRAAQMGL TGNGGYGWSA PIHYQQAWPQ  120
PSPPRLYIDP VGPMPPSIPP MMRMMDFSTT EQETILFEGV FQECRKRPIV GVEDEVDDEN  180
VRLELMLGDS ATKKPKIDLT LTLEPPVNEG HDSSRPNV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A328D1713e-29A0A328D171_9ASTE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74502029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-18G2-like family protein