PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000017.1_g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 245aa    MW: 26677.4 Da    PI: 5.7362
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000017.1_g00040.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.71.1e-224598255
                  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             pr +Wtp+LH+rF+ea++ LGG + AtP++i e+m+ k+Lt++ v+SHL  +R 
  Itr_sc000017.1_g00040.1 45 PRFKWTPDLHRRFLEAIQVLGGLQYATPRAIAEVMDDKDLTISRVRSHLEIHRA 98
                             8************************************************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-194398IPR009057Homeodomain-like
SuperFamilySSF466893.05E-114397IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-184597IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MAENFSPSSS SSSPFPSVRP SIEGGQSSSA PENPTGTGFY PQPTPRFKWT PDLHRRFLEA  60
IQVLGGLQYA TPRAIAEVMD DKDLTISRVR SHLEIHRANC FDPEQLARET QAAVAQMAWA  120
ATVPYPYGYP SLYSAPAPAL YSPLRPQLTS PPLPPPARLY IGPFGPIMPP TIPPSMRMME  180
YSAPTPKTII FKMMGTPVSI DAEEIPELMM SGDINPGPSS SAARNEGQDD GPLDLTLSIR  240
PPSRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019171617.16e-90PREDICTED: transcription activator GLK2-like isoform X3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120621623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-17G2-like family protein