PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000014.1_g00033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CO-like
Protein Properties Length: 363aa    MW: 39302.6 Da    PI: 6.1889
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000014.1_g00033.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.81.6e-061143436
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                             + C+ ++   ++ fC  +  +lC  C +++H  
  Itr_sc000014.1_g00033.1 11 KLCDSCKAVSATVFCGADTAFLCLACDSKIHAA 43
                             68******99*********************54 PP

2zf-B_box28.82.6e-095397341
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                              ++C+ +e+ ++++ C+ +   lC +C   +H+       H++ p
  Itr_sc000014.1_g00033.1 53 VWVCEVCEQAPASFTCKADAAALCVTCDRDIHSAnplarrHERLP 97
                             689*****************************6688888898877 PP

3CCT69.67.9e-24300344145
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                              Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k+ae
  Itr_sc000014.1_g00033.1 300 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRAE 344
                              9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.4E-9855IPR000315B-box-type zinc finger
PROSITE profilePS501199.542855IPR000315B-box-type zinc finger
CDDcd000212.34E-71255No hitNo description
PROSITE profilePS5011910.8795198IPR000315B-box-type zinc finger
PfamPF006431.7E-75398IPR000315B-box-type zinc finger
CDDcd000216.80E-105498No hitNo description
SMARTSM003361.2E-105698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787300342IPR010402CCT domain
PfamPF062036.9E-18300342IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGAESWSLTA KLCDSCKAVS ATVFCGADTA FLCLACDSKI HAANKLASRH ARVWVCEVCE  60
QAPASFTCKA DAAALCVTCD RDIHSANPLA RRHERLPVVP FYDSAAAAAK SHGAAGPASP  120
GGDDDTKYFS NESDNQNAEE AEEEAEAASW LLPTPNNAKG GVDLEGSEYK SADYLFNDMD  180
PYLDMEMISG GGDQKPHHHN HHQHYNSDGV VPVQKKTETR HVPGPVVDGF PTYEIDFAAG  240
SKPPFMYNFA SQSISQSVSS SSMEVGVVPD HNAMADVSNA PFNRTSGGDA VPNPVSGLDR  300
EARVLRYREK RKNRKFEKTI RYASRKAYAE TRPRIKGRFA KRAETEADSL LAADASYGVV  360
PSY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019176784.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ9FHH81e-101COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A328DV530.0A0A328DV53_9ASTE; Uncharacterized protein
STRINGXP_009590370.11e-179(Nicotiana tomentosiformis)
STRINGXP_009618115.11e-179(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-93CONSTANS-like 4
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]