PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000011.1_g00055.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 396aa    MW: 44063.2 Da    PI: 4.7641
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000011.1_g00055.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.4e-33185239155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              kpr+rWtpeLHe Fveav++LGG ekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Itr_sc000011.1_g00055.1 185 KPRMRWTPELHEVFVEAVNKLGGMEKATPKGVLNLMKVEGLTIYHVKSHLQKYRT 239
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.894182242IPR017930Myb domain
SuperFamilySSF466894.84E-18182239IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-31184240IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-25185240IPR006447Myb domain, plants
PfamPF002493.6E-9187238IPR001005SANT/Myb domain
PfamPF143791.1E-21270316IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MNMRPAVFLQ ISSEAEHSKI GVSGAISTSL PIIEERYPKL PDAFHARSEH KETANSFSSM  60
TIPSASNNVD SWGNDAYHEF LDYKPNISVQ NGQVETLAGV MSSDDYAKRK DWQEWADELI  120
NDDDALDPNW SDILVDVNFP DPEPKLLPGS TDVAVSQPQL NHPTPTSSEQ NCPSAGPLST  180
ATLTKPRMRW TPELHEVFVE AVNKLGGMEK ATPKGVLNLM KVEGLTIYHV KSHLQKYRTT  240
RYKTEPTEGS SEKKPVTIPD LASFDLKPSM GITEALRLQM EVQKQLHEQL ETQRKLQLQI  300
EEQGKYLQMM YEKTREMEKE LKASSSKPDE HPVSPPATDN QEPLNLDNTN TELSANNASS  360
SGAVLTQNQS SEATSQENIA CEPPMKRARA NETAVC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-29185243260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-29185243260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-29185243260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-29185243260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-29185243260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-29185243260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-29185243260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-29185243260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:11511543, PubMed:17927693, PubMed:26586833). Binds as a dimer to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:11511543, PubMed:20838596, PubMed:26586833). SPX1 is a competitive inhibitor of this DNA-binding (PubMed:25271326). PHR1 binding to its targets is low Pi-dependent (PubMed:25271326). Regulates the expression of miR399 (PubMed:20838596). Regulates the expression of IPS1 (At3g09922), a non-coding RNA that mimics the target of miR399 to block the cleavage of PHO2 under Pi-deficient conditions (PubMed:17643101). Regulates lipid remodeling and triacylglycerol accumulation during phosphorus starvation (PubMed:25680792). Required for the shoot-specific hypoxic response (PubMed:24753539). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). Contributes to the homeostasis of both sulfate and phosphate in plants under phosphate deficiency (PubMed:21261953). Required for adaptation to high light and retaining functional photosynthesis during phosphate starvation (PubMed:21910737). Involved in the coregulation of Zn and Pi homeostasis (PubMed:24420568). {ECO:0000269|PubMed:11511543, ECO:0000269|PubMed:17643101, ECO:0000269|PubMed:17927693, ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:21261953, ECO:0000269|PubMed:21910737, ECO:0000269|PubMed:23788639, ECO:0000269|PubMed:24420568, ECO:0000269|PubMed:24753539, ECO:0000269|PubMed:25271326, ECO:0000269|PubMed:25680792, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Only moderately up-regulated by Pi starvation. {ECO:0000269|PubMed:11511543}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019192910.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 1-like isoform X2
SwissprotQ94CL79e-80PHR1_ARATH; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLA0A0V0ICE01e-151A0A0V0ICE0_SOLCH; Uncharacterized protein
STRINGXP_009593796.11e-133(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.14e-82phosphate starvation response 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Matsui K,Togami J,Mason JG,Chandler SF,Tanaka Y
    Enhancement of phosphate absorption by garden plants by genetic engineering: a new tool for phytoremediation.
    Biomed Res Int, 2013. 2013: p. 182032
    [PMID:23984322]
  3. Jost R, et al.
    Differentiating phosphate-dependent and phosphate-independent systemic phosphate-starvation response networks in Arabidopsis thaliana through the application of phosphite.
    J. Exp. Bot., 2015. 66(9): p. 2501-14
    [PMID:25697796]
  4. Zhou Z, et al.
    SPX proteins regulate Pi homeostasis and signaling in different subcellular level.
    Plant Signal Behav, 2015. 10(9): p. e1061163
    [PMID:26224365]
  5. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  6. Khan GA,Vogiatzaki E,Glauser G,Poirier Y
    Phosphate Deficiency Induces the Jasmonate Pathway and Enhances Resistance to Insect Herbivory.
    Plant Physiol., 2016. 171(1): p. 632-44
    [PMID:27016448]
  7. Velasco VM, et al.
    Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes.
    Plant Cell Environ., 2016. 39(8): p. 1818-34
    [PMID:27038434]
  8. Yong-Villalobos L, et al.
    Phosphate starvation induces DNA methylation in the vicinity of cis-acting elements known to regulate the expression of phosphate-responsive genes.
    Plant Signal Behav, 2016. 11(5): p. e1173300
    [PMID:27185363]
  9. Li Y,Wu H,Fan H,Zhao T,Ling HQ
    Characterization of the AtSPX3 Promoter Elucidates its Complex Regulation in Response to Phosphorus Deficiency.
    Plant Cell Physiol., 2016. 57(8): p. 1767-78
    [PMID:27382128]
  10. Zhang H,Huang L,Hong Y,Song F
    BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana.
    BMC Plant Biol., 2016. 16(1): p. 152
    [PMID:27389008]
  11. Yuan J, et al.
    Systematic characterization of novel lncRNAs responding to phosphate starvation in Arabidopsis thaliana.
    BMC Genomics, 2016. 17: p. 655
    [PMID:27538394]
  12. Linn J, et al.
    Root Cell-Specific Regulators of Phosphate-Dependent Growth.
    Plant Physiol., 2017. 174(3): p. 1969-1989
    [PMID:28465462]
  13. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]
  14. Liu Y, et al.
    Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1.
    Plant Cell, 2017. 29(9): p. 2269-2284
    [PMID:28842534]
  15. Qi W,Manfield IW,Muench SP,Baker A
    AtSPX1 affects the AtPHR1-DNA-binding equilibrium by binding monomeric AtPHR1 in solution.
    Biochem. J., 2017. 474(21): p. 3675-3687
    [PMID:28887383]
  16. Huang KL, et al.
    The ARF7 and ARF19 Transcription Factors Positively Regulate PHOSPHATE STARVATION RESPONSE1 in Arabidopsis Roots.
    Plant Physiol., 2018. 178(1): p. 413-427
    [PMID:30026290]
  17. Jiang M, et al.
    Structural basis for the Target DNA recognition and binding by the MYB domain of phosphate starvation response 1.
    FEBS J., 2019.
    [PMID:30974511]