PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000005.1_g00047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 429aa    MW: 46519.4 Da    PI: 7.4648
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000005.1_g00047.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-32240293255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Itr_sc000005.1_g00047.1 240 PRMRWTSTLHSRFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 293
                              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15237293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28238293IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-24240293IPR006447Myb domain, plants
PfamPF002498.2E-7241292IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MPLEGVFIEP SSSSSNPDLS LHISLPVAAA GNDLSAGNAK SAAAQMYTDL SLARPTKTND  60
QERRFVSMDS SAGQRNEVWE DRQFLRGTKQ GQGQHFLGFQ GGNDGVSGEL GGLSPPIKGI  120
PVYQSRGFPF LGTDRHPRYA DPKICFHSSP YFSGGGLDHL SILNNTAPAS AAAYGANLAA  180
AGRFNGLSSP YQVPQHHHQY GVSGASHNHH LSDAPPSHGG LTMRSRFYPK LPAKRSMRAP  240
RMRWTSTLHS RFVHAVELLG GHERATPKSV LELMDVKDLT LAHVKSHLQM YRTVKTTSSK  300
PAASSGQSDG SGDEDQSSLG SAGPGGGDRS GIHQFMDQRA SALQPEPEFL SPTAVWGNSS  360
SGEGLLETSS NETNGMRSSS FPMQQRSEHH HIQEWESDER PKRCIGWEQT NPSLEFTLGR  420
PDWIPKDHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16241295357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16241295357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16241295357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16241295357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019182739.10.0PREDICTED: transcription repressor KAN1-like
TrEMBLA0A068TZL41e-109A0A068TZL4_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000346631e-105(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-63G2-like family protein