PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_81908.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 378aa    MW: 41094.2 Da    PI: 4.6318
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_81908.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.22.7e-38631621100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   aCaaCk++rrkC++dC+lapyfpa+q+++f n+h+lFG+sn+lk+l++l++e  e+am++l+y+Ae+ra dPv G++++i +l++  e l+aela+l
  MLOC_81908.1  63 ACAACKYQRRKCNPDCPLAPYFPADQQRRFLNAHRLFGVSNILKTLRRLKPELCEAAMQTLIYQAEMRAMDPVGGCCRMIIDLEHTSELLAAELAAL 159
                   7**********************************************************************************************99 PP

        DUF260  98 kee 100
                   +++
  MLOC_81908.1 160 NQH 162
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.58462163IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-3763160IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MTSSSAASSS HLHITITNAS STITTNTKSQ SQHNHSSSVS PRSGGSGGGG SGSGSGSGTT  60
NQACAACKYQ RRKCNPDCPL APYFPADQQR RFLNAHRLFG VSNILKTLRR LKPELCEAAM  120
QTLIYQAEMR AMDPVGGCCR MIIDLEHTSE LLAAELAALN QHLDLYRQAA SGVAGGDVMD  180
GPCADLEVTS SNHQQEQLLL HADQDQVVDT LYVAQEVADP VIQNGADHDD NRQPQYHGGQ  240
QQQQLYDYFY YEATGAGGDE AGRKPGGSGV DINVDVMQHF DYDSSCEVDD HHKVDQLEPM  300
ISSSLDEHYP IGQKEYEMKV ASFVDVLDVR PEMQAMDGNA DIGVKEELQE EEDPKNNIEL  360
SKATHMAESS HCRLGLGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-226417512121LOB family transfactor Ramosa2.1
5ly0_B2e-226417512121LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_81908.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3757490.0AK375749.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3103F07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020151955.10.0uncharacterized protein LOC109737153
TrEMBLF2EHX20.0F2EHX2_HORVV; Predicted protein
STRINGMLOC_81908.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-32LOB domain-containing protein 22