PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_79754.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family G2-like
Protein Properties Length: 180aa    MW: 18826.1 Da    PI: 9.715
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_79754.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.99.7e-3362115255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  MLOC_79754.2  62 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 115
                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.02E-1659116IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-2960116IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2462115IPR006447Myb domain, plants
PfamPF002491.9E-763114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MLSASGRLNG MLSDTLRSYG APGGGVGMGL GGHHHHLHGA QPFGLGSRFM PKLPAKRSMR  60
APRMRWTSTL HARFVHAVEL LGGHERATPK SVLELMDVKD LTLAHVKSHL QMYRTVKSTD  120
KPAASGPTDG GSGDDDFPSA GQAGSGGDNM CPRPFPEHRS TSEGAASSVG GDMDQSSAGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_79754.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3771030.0AK377103.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3148F08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020150556.14e-95probable transcription factor RL9
SwissprotQ0J2355e-71ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A287REY41e-124A0A287REY4_HORVV; Uncharacterized protein
STRINGMLOC_79754.21e-127(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-46G2-like family protein